Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 824871..825525 | Replicon | chromosome |
| Accession | NZ_LR134485 | ||
| Organism | Citrobacter youngae strain NCTC13709 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | EL296_RS04085 | Protein ID | WP_048213165.1 |
| Coordinates | 825118..825525 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | EL296_RS04080 | Protein ID | WP_124020890.1 |
| Coordinates | 824871..825137 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL296_RS04055 | 820073..821506 | - | 1434 | WP_124020891.1 | 6-phospho-beta-glucosidase BglA | - |
| EL296_RS04060 | 821626..822354 | - | 729 | WP_061068520.1 | MurR/RpiR family transcriptional regulator | - |
| EL296_RS04065 | 822407..822718 | + | 312 | WP_048213167.1 | N(4)-acetylcytidine aminohydrolase | - |
| EL296_RS04070 | 822882..823541 | + | 660 | WP_101742747.1 | hemolysin III family protein | - |
| EL296_RS04075 | 823635..824615 | - | 981 | WP_048213166.1 | tRNA-modifying protein YgfZ | - |
| EL296_RS04080 | 824871..825137 | + | 267 | WP_124020890.1 | FAD assembly factor SdhE | Antitoxin |
| EL296_RS04085 | 825118..825525 | + | 408 | WP_048213165.1 | protein YgfX | Toxin |
| EL296_RS04090 | 825616..826137 | - | 522 | WP_048213164.1 | flavodoxin FldB | - |
| EL296_RS04095 | 826251..827147 | + | 897 | WP_005123354.1 | site-specific tyrosine recombinase XerD | - |
| EL296_RS04100 | 827171..827884 | + | 714 | WP_101742745.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL296_RS04105 | 827890..829623 | + | 1734 | WP_115601508.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15940.86 Da Isoelectric Point: 10.9468
>T287931 WP_048213165.1 NZ_LR134485:825118-825525 [Citrobacter youngae]
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVCAPWMIKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQQVKQG
VVQWQSDLRVSWRAQWLSLLIHGLVAVFILLMPWPLSYTPLWLVLLSLVVFDSVRSQRRINACQGEIRLLMDGRLRWQGQ
EWSIVCAPWMIKTGMMLRLRSDAGKRQHLWLAADSMDDAEWRDLRRLMLQQVKQG
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|