Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF-RHH
Location 1971728..1972356 Replicon chromosome
Accession NZ_LR134483
Organism Listeria grayi strain NCTC 10812

Toxin (Protein)


Gene name mazF Uniprot ID A0A829R4Z3
Locus tag EL241_RS09600 Protein ID WP_036106093.1
Coordinates 1971728..1972072 (-) Length 115 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID D7V0P1
Locus tag EL241_RS09605 Protein ID WP_003754839.1
Coordinates 1972078..1972356 (-) Length 93 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL241_RS09565 1967275..1968054 - 780 WP_003754848.1 RNA polymerase sigma factor SigB -
EL241_RS09570 1968032..1968505 - 474 WP_003754846.1 anti-sigma B factor RsbW -
EL241_RS09575 1968489..1968833 - 345 WP_003754845.1 STAS domain-containing protein -
EL241_RS09580 1968900..1969904 - 1005 WP_036106103.1 PP2C family protein-serine/threonine phosphatase -
EL241_RS09585 1969916..1970326 - 411 WP_003754843.1 anti-sigma regulatory factor -
EL241_RS09590 1970331..1970687 - 357 WP_036106099.1 STAS domain-containing protein -
EL241_RS09595 1970693..1971529 - 837 WP_036106096.1 STAS domain-containing protein -
EL241_RS09600 1971728..1972072 - 345 WP_036106093.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
EL241_RS09605 1972078..1972356 - 279 WP_003754839.1 ribbon-helix-helix protein, CopG family Antitoxin
EL241_RS09610 1972529..1973635 - 1107 WP_036106090.1 alanine racemase -
EL241_RS09615 1973637..1974005 - 369 WP_036106087.1 holo-ACP synthase -
EL241_RS09620 1974002..1975387 - 1386 WP_036106086.1 protoporphyrinogen oxidase -
EL241_RS09625 1975491..1975979 - 489 WP_003754833.1 QueT transporter family protein -
EL241_RS09630 1976097..1976375 - 279 WP_003754831.1 hypothetical protein -
EL241_RS09635 1976376..1976732 - 357 WP_036106083.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-111)

Antitoxin

Ribbon-helix-helix protein, CopG

(11-45)


Sequences

Toxin        


Download         Length: 115 a.a.        Molecular weight: 12668.66 Da        Isoelectric Point: 6.4844

>T287929 WP_036106093.1 NZ_LR134483:c1972072-1971728 [Listeria grayi]
MVKRGDVYYADLSPVVGSEQGGTRPVLIIQNDIGNRHSPTVIVAAITAKIQKAKLPTHVEAMRKDGFDRDSVILLEQVRT
IDKQRLTDKITHLDDELMEKVDHALVISLGLIDL

Download         Length: 345 bp

Antitoxin


Download         Length: 93 a.a.        Molecular weight: 10687.21 Da        Isoelectric Point: 4.6144

>AT287929 WP_003754839.1 NZ_LR134483:c1972356-1972078 [Listeria grayi]
VLEKLEWTTMSIELTQETMSELDVLARKQRIEKNEIIDRAVKQYISQQKVRDLRVEMERGYAEMANINFAIACECTHVES
EAEDKNIRVLGG

Download         Length: 279 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829R4Z3

Antitoxin

Source ID Structure
AlphaFold DB A0A829R4T2

References