Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 310233..310819 Replicon chromosome
Accession NZ_LR134475
Organism Klebsiella aerogenes strain NCTC9735

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag EL280_RS01465 Protein ID WP_002920800.1
Coordinates 310451..310819 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag EL280_RS01460 Protein ID WP_004174006.1
Coordinates 310233..310454 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL280_RS01440 306374..307300 + 927 WP_015369323.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
EL280_RS01445 307297..308574 + 1278 WP_117026020.1 branched chain amino acid ABC transporter permease LivM -
EL280_RS01450 308571..309338 + 768 WP_015369325.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
EL280_RS01455 309356..310069 + 714 WP_086538103.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
EL280_RS01460 310233..310454 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL280_RS01465 310451..310819 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
EL280_RS01470 311092..312408 + 1317 WP_015703703.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
EL280_RS01475 312515..313402 + 888 WP_015369328.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
EL280_RS01480 313399..314244 + 846 WP_015369329.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
EL280_RS01485 314246..315316 + 1071 WP_015703701.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 307297..316053 8756


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T287890 WP_002920800.1 NZ_LR134475:310451-310819 [Klebsiella aerogenes]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT287890 WP_004174006.1 NZ_LR134475:310233-310454 [Klebsiella aerogenes]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References