Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 979714..980408 | Replicon | chromosome |
Accession | NZ_LR134373 | ||
Organism | Yersinia pseudotuberculosis strain NCTC10275 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | - |
Locus tag | EL213_RS04235 | Protein ID | WP_024063131.1 |
Coordinates | 979714..980010 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | Q666X1 |
Locus tag | EL213_RS04240 | Protein ID | WP_002209924.1 |
Coordinates | 980010..980408 (+) | Length | 133 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL213_RS04205 | 974836..976353 | + | 1518 | WP_002209930.1 | lysine--tRNA ligase | - |
EL213_RS04215 | 976786..978000 | + | 1215 | WP_011192954.1 | tyrosine-type recombinase/integrase | - |
EL213_RS04220 | 978082..978267 | - | 186 | WP_002209928.1 | hypothetical protein | - |
EL213_RS04225 | 978865..979125 | + | 261 | WP_002214785.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL213_RS04230 | 979188..979550 | + | 363 | WP_011192920.1 | helix-turn-helix domain-containing protein | - |
EL213_RS04235 | 979714..980010 | + | 297 | WP_024063131.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
EL213_RS04240 | 980010..980408 | + | 399 | WP_002209924.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
EL213_RS04245 | 980808..983099 | - | 2292 | WP_024063132.1 | toprim domain-containing protein | - |
EL213_RS04250 | 983399..983725 | + | 327 | WP_002209922.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
EL213_RS21250 | 983718..983870 | + | 153 | WP_002209921.1 | hypothetical protein | - |
EL213_RS04255 | 983884..984084 | - | 201 | WP_002209920.1 | AlpA family transcriptional regulator | - |
EL213_RS04260 | 984266..984922 | - | 657 | WP_024063133.1 | hypothetical protein | - |
EL213_RS04265 | 984935..985300 | - | 366 | WP_011192915.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11318.17 Da Isoelectric Point: 7.8810
>T287822 WP_024063131.1 NZ_LR134373:979714-980010 [Yersinia pseudotuberculosis]
MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDAVSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRV
YLKITVIDDVLIVSFKEI
MEKRTPHTRLLKVKELVLKGNIKTTRTARDGAEELGLSFRDMCDAVSELISADFYKSMTTHQDHTIWQDVYRPMLSCGRV
YLKITVIDDVLIVSFKEI
Download Length: 297 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14657.17 Da Isoelectric Point: 8.4923
>AT287822 WP_002209924.1 NZ_LR134373:980010-980408 [Yersinia pseudotuberculosis]
MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETVMTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRK
KLGLNQREASEIFGGGVNAFSRYEKGKALPHPSTIKLLQVLDKHPELLNEIR
MMKCPVCGGVELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETVMTEAESDVYAAKTMLLRKMVNTESIAPAYIVQIRK
KLGLNQREASEIFGGGVNAFSRYEKGKALPHPSTIKLLQVLDKHPELLNEIR
Download Length: 399 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|