Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/RelB(antitoxin) |
| Location | 1759331..1759967 | Replicon | chromosome |
| Accession | NZ_LR134354 | ||
| Organism | Bifidobacterium longum subsp. infantis strain NCTC11817 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | W6EZW1 |
| Locus tag | EL189_RS08775 | Protein ID | WP_014484977.1 |
| Coordinates | 1759611..1759967 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | D6PAX1 |
| Locus tag | EL189_RS08770 | Protein ID | WP_012577921.1 |
| Coordinates | 1759331..1759624 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL189_RS08745 | 1754403..1754858 | - | 456 | WP_012577916.1 | Holliday junction resolvase RuvX | - |
| EL189_RS08750 | 1754867..1757545 | - | 2679 | WP_012577917.1 | alanine--tRNA ligase | - |
| EL189_RS13820 | 1757674..1757910 | - | 237 | WP_012577918.1 | hypothetical protein | - |
| EL189_RS08760 | 1757910..1758308 | - | 399 | WP_012577919.1 | DUF948 domain-containing protein | - |
| EL189_RS08765 | 1758391..1759074 | - | 684 | WP_012577920.1 | histidine phosphatase family protein | - |
| EL189_RS08770 | 1759331..1759624 | + | 294 | WP_012577921.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EL189_RS08775 | 1759611..1759967 | + | 357 | WP_014484977.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| EL189_RS08780 | 1760144..1760746 | - | 603 | WP_012577923.1 | transglutaminase family protein | - |
| EL189_RS08785 | 1760851..1761207 | - | 357 | WP_012577924.1 | SdpI family protein | - |
| EL189_RS08790 | 1761300..1761740 | + | 441 | WP_012577925.1 | cytidine deaminase | - |
| EL189_RS08795 | 1761923..1762705 | + | 783 | WP_012577926.1 | gamma-glutamyl-gamma-aminobutyrate hydrolase family protein | - |
| EL189_RS08800 | 1762884..1763510 | - | 627 | WP_007052130.1 | 30S ribosomal protein S4 | - |
| EL189_RS08805 | 1763709..1764701 | - | 993 | WP_012577927.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13302.25 Da Isoelectric Point: 8.9603
>T287799 WP_014484977.1 NZ_LR134354:1759611-1759967 [Bifidobacterium longum subsp. infantis]
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
MMKTDPRQFEIWWVPFAFPDKPGKAKNRPSVILQWDDGTRIALVTKVTGNTWRDEPGYVVLRDWQDAGLSKPSAVRCSQL
LRLPSNLFLDDGPTGRLSAYDAGRVAWAINELYPGLLA
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0L7D489 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1S2VTZ6 |