Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
| Location | 2472083..2472306 | Replicon | chromosome |
| Accession | NZ_LR134340 | ||
| Organism | Escherichia marmotae strain NCTC11133 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A7H9K3A2 |
| Locus tag | EL192_RS11890 | Protein ID | WP_032141347.1 |
| Coordinates | 2472199..2472306 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2472083..2472149 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL192_RS11865 | 2467363..2468757 | - | 1395 | WP_016248766.1 | YchO/YchP family invasin | - |
| EL192_RS11870 | 2468941..2469294 | + | 354 | WP_001169672.1 | DsrE/F sulfur relay family protein YchN | - |
| EL192_RS11875 | 2469338..2470033 | - | 696 | WP_016248767.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| EL192_RS11880 | 2470191..2470421 | - | 231 | WP_001146437.1 | putative cation transport regulator ChaB | - |
| EL192_RS11885 | 2470690..2471790 | + | 1101 | WP_001516524.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 2472083..2472149 | - | 67 | - | - | Antitoxin |
| EL192_RS11890 | 2472199..2472306 | + | 108 | WP_032141347.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| EL192_RS11895 | 2472486..2473340 | - | 855 | WP_000811071.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| EL192_RS11900 | 2473376..2474185 | - | 810 | WP_016248768.1 | invasion regulator SirB1 | - |
| EL192_RS11905 | 2474189..2474581 | - | 393 | WP_000200357.1 | invasion regulator SirB2 | - |
| EL192_RS11910 | 2474578..2475411 | - | 834 | WP_000456440.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| EL192_RS11915 | 2475411..2476493 | - | 1083 | WP_000804714.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3953.71 Da Isoelectric Point: 11.4779
>T287755 WP_032141347.1 NZ_LR134340:2472199-2472306 [Escherichia marmotae]
MTLAQFAITFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAITFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
Antitoxin
Download Length: 67 bp
>AT287755 NZ_LR134340:c2472149-2472083 [Escherichia marmotae]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTGACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|