Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 3545843..3546537 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | A0A7U7FJ92 |
| Locus tag | EL202_RS16710 | Protein ID | WP_005166025.1 |
| Coordinates | 3545843..3546139 (+) | Length | 99 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | A0A7U7IQA2 |
| Locus tag | EL202_RS16715 | Protein ID | WP_005166024.1 |
| Coordinates | 3546139..3546537 (+) | Length | 133 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS16675 | 3541316..3542414 | + | 1099 | WP_020282590.1 | peptide chain release factor 2 | - |
| EL202_RS16680 | 3542424..3543941 | + | 1518 | WP_005166031.1 | lysine--tRNA ligase | - |
| EL202_RS16700 | 3544998..3545258 | + | 261 | WP_005166028.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EL202_RS16705 | 3545324..3545686 | + | 363 | WP_005166026.1 | helix-turn-helix domain-containing protein | - |
| EL202_RS16710 | 3545843..3546139 | + | 297 | WP_005166025.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| EL202_RS16715 | 3546139..3546537 | + | 399 | WP_005166024.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| EL202_RS16720 | 3546644..3547846 | - | 1203 | WP_005177049.1 | IS256 family transposase | - |
| EL202_RS16725 | 3547995..3548195 | - | 201 | WP_005166614.1 | AlpA family transcriptional regulator | - |
| EL202_RS16730 | 3548213..3549049 | + | 837 | Protein_3144 | Fic family protein | - |
| EL202_RS16735 | 3549421..3549816 | + | 396 | WP_005166615.1 | SgcJ/EcaC family oxidoreductase | - |
| EL202_RS16740 | 3549899..3551143 | + | 1245 | WP_005166619.1 | sensor domain-containing diguanylate cyclase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11322.18 Da Isoelectric Point: 7.7766
>T287738 WP_005166025.1 NZ_LR134335:3545843-3546139 [Yersinia enterocolitica subsp. palearctica]
MEKRTPHTRLLKVKELVLKGNVKSTRTARDGAEELGLSFRDMCDVVCELTSADFYKSMTTHQDHTIWQDVYRPMLSCGRV
YLKITVIDDVLIVSFKEL
MEKRTPHTRLLKVKELVLKGNVKSTRTARDGAEELGLSFRDMCDVVCELTSADFYKSMTTHQDHTIWQDVYRPMLSCGRV
YLKITVIDDVLIVSFKEL
Download Length: 297 bp
Antitoxin
Download Length: 133 a.a. Molecular weight: 14716.19 Da Isoelectric Point: 8.8165
>AT287738 WP_005166024.1 NZ_LR134335:3546139-3546537 [Yersinia enterocolitica subsp. palearctica]
MMKCPVCGGAELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETIMTEAESDTYAAKTMLLRKMVNTESIAPAYIVQVRK
KLGLNQREASEIFGGGVNAFSRYEKGKALPHRSTIKLLQVLDKYPELLNEIR
MMKCPVCGGAELIHEARDVPFTYKGRKFIVEGVIGQHCPACGETIMTEAESDTYAAKTMLLRKMVNTESIAPAYIVQVRK
KLGLNQREASEIFGGGVNAFSRYEKGKALPHRSTIKLLQVLDKYPELLNEIR
Download Length: 399 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7FJ92 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7IQA2 |