Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
| Location | 3223019..3223546 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7T9XW08 |
| Locus tag | EL202_RS15340 | Protein ID | WP_005166250.1 |
| Coordinates | 3223271..3223546 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A7T9XW39 |
| Locus tag | EL202_RS15335 | Protein ID | WP_005166251.1 |
| Coordinates | 3223019..3223267 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS15310 | 3219619..3220713 | + | 1095 | WP_005166255.1 | LPS export ABC transporter permease LptF | - |
| EL202_RS15315 | 3220713..3221783 | + | 1071 | WP_005166254.1 | LPS export ABC transporter permease LptG | - |
| EL202_RS15325 | 3222080..3222588 | - | 509 | Protein_2879 | helix-turn-helix domain containing protein | - |
| EL202_RS15330 | 3222649..3222942 | + | 294 | Protein_2880 | DUF4942 domain-containing protein | - |
| EL202_RS15335 | 3223019..3223267 | + | 249 | WP_005166251.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
| EL202_RS15340 | 3223271..3223546 | + | 276 | WP_005166250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL202_RS15345 | 3223665..3224453 | + | 789 | WP_005166249.1 | helix-turn-helix domain-containing protein | - |
| EL202_RS15350 | 3224681..3224812 | + | 132 | Protein_2884 | IS3 family transposase | - |
| EL202_RS15355 | 3224866..3225591 | - | 726 | WP_005180647.1 | IS21-like element ISYen2A/ISYen2B family helper ATPase IstB | - |
| EL202_RS15360 | 3225578..3227086 | - | 1509 | WP_005180650.1 | IS21-like element ISYen2A family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10974.31 Da Isoelectric Point: 4.5486
>T287736 WP_005166250.1 NZ_LR134335:3223271-3223546 [Yersinia enterocolitica subsp. palearctica]
MEIYWTLKAQDDLERIYCFALQYSRQHGDDVLDRLITGCAGLTAYPAIGVQQTRYEPREVRKVLFDDYEVHYELRDNDIY
IVDLWHTKEER
MEIYWTLKAQDDLERIYCFALQYSRQHGDDVLDRLITGCAGLTAYPAIGVQQTRYEPREVRKVLFDDYEVHYELRDNDIY
IVDLWHTKEER
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T9XW08 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T9XW39 |