Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 3187284..3187819 Replicon chromosome
Accession NZ_LR134335
Organism Yersinia enterocolitica subsp. palearctica strain NCTC13769

Toxin (Protein)


Gene name relE Uniprot ID A0A7U7FI46
Locus tag EL202_RS15155 Protein ID WP_005156226.1
Coordinates 3187532..3187819 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A7U7FI63
Locus tag EL202_RS15150 Protein ID WP_005156229.1
Coordinates 3187284..3187535 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL202_RS15125 3182501..3183385 + 885 WP_005156239.1 sugar ABC transporter permease -
EL202_RS15130 3183404..3184243 + 840 WP_005156238.1 carbohydrate ABC transporter permease -
EL202_RS15135 3184255..3185370 + 1116 WP_005156237.1 ABC transporter ATP-binding protein -
EL202_RS15140 3185384..3186550 + 1167 WP_005156235.1 alginate lyase family protein -
EL202_RS15145 3186624..3187076 + 453 WP_005181269.1 YhbP family protein -
EL202_RS15150 3187284..3187535 + 252 WP_005156229.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
EL202_RS15155 3187532..3187819 + 288 WP_005156226.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL202_RS15160 3187895..3188524 + 630 WP_005175332.1 hypothetical protein -
EL202_RS15165 3188525..3189292 - 768 WP_005156220.1 phosphonate metabolism protein PhnP -
EL202_RS15170 3189283..3189860 - 578 Protein_2850 ribose 1,5-bisphosphokinase -
EL202_RS15175 3189860..3191008 - 1149 WP_005156213.1 alpha-D-ribose 1-methylphosphonate 5-triphosphate diphosphatase -
EL202_RS15180 3191005..3191739 - 735 WP_005156211.1 phosphonate C-P lyase system protein PhnL -
EL202_RS15185 3191753..3192559 - 807 WP_005156209.1 phosphonate C-P lyase system protein PhnK -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11002.07 Da        Isoelectric Point: 10.3544

>T287735 WP_005156226.1 NZ_LR134335:3187532-3187819 [Yersinia enterocolitica subsp. palearctica]
MIYKVKFRSDALKEWGKIDKVIQQQFAKKLKKCCENPHIPSAKLRGLSDCYKIKLRASGFRLVYQVIEDCLVIAVVAVGK
RERSDVYNLASERLR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9270.65 Da        Isoelectric Point: 4.2264

>AT287735 WP_005156229.1 NZ_LR134335:3187284-3187535 [Yersinia enterocolitica subsp. palearctica]
MANIILSDTSASVSELKKNPMATVKAGAGYPVAILNRNQPAFYCIPAELYERMLDALDDQELIRLVTERESQPLIDVDLD
KYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U7FI46

Antitoxin

Source ID Structure
AlphaFold DB A0A7U7FI63

References