Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 2742936..2743520 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | A0A7U7ISC5 |
| Locus tag | EL202_RS13010 | Protein ID | WP_005165296.1 |
| Coordinates | 2742936..2743304 (-) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | EL202_RS13015 | Protein ID | WP_129019424.1 |
| Coordinates | 2743368..2743520 (-) | Length | 51 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS12990 | 2738143..2739063 | + | 921 | WP_005165286.1 | ROK family protein | - |
| EL202_RS12995 | 2739148..2740110 | + | 963 | WP_005165289.1 | LacI family transcriptional regulator | - |
| EL202_RS13000 | 2740144..2740617 | - | 474 | WP_005165291.1 | GNAT family N-acetyltransferase | - |
| EL202_RS13005 | 2741853..2742707 | - | 855 | WP_005165294.1 | DUF4942 domain-containing protein | - |
| EL202_RS13010 | 2742936..2743304 | - | 369 | WP_005165296.1 | TA system toxin CbtA family protein | Toxin |
| EL202_RS13015 | 2743368..2743520 | - | 153 | WP_129019424.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL202_RS13020 | 2743589..2744791 | + | 1203 | WP_005178352.1 | IS256 family transposase | - |
| EL202_RS13025 | 2744966..2746429 | + | 1464 | WP_005166182.1 | alpha/beta hydrolase | - |
| EL202_RS13030 | 2746662..2748068 | - | 1407 | WP_005166180.1 | filamentous hemagglutinin N-terminal domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2743589..2744791 | 1202 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13609.55 Da Isoelectric Point: 6.4731
>T287733 WP_005165296.1 NZ_LR134335:c2743304-2742936 [Yersinia enterocolitica subsp. palearctica]
MQTLPVTSKRAAYACLSPVIVWQSMLTYLLEQHYGLVLSDTEFSDDAVIHEHIDAGISLADALNFTVEKFDLARTDHRGF
SCQEQSPFITSIDILRARRATGLMTRMGYQTITSVIRGGKQA
MQTLPVTSKRAAYACLSPVIVWQSMLTYLLEQHYGLVLSDTEFSDDAVIHEHIDAGISLADALNFTVEKFDLARTDHRGF
SCQEQSPFITSIDILRARRATGLMTRMGYQTITSVIRGGKQA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|