Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 2681786..2682429 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A7U7IT36 |
| Locus tag | EL202_RS12755 | Protein ID | WP_005161957.1 |
| Coordinates | 2682010..2682429 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A0E1NFG4 |
| Locus tag | EL202_RS12750 | Protein ID | WP_005161959.1 |
| Coordinates | 2681786..2682013 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS12725 | 2676899..2678062 | + | 1164 | WP_005161974.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| EL202_RS12730 | 2678294..2678848 | + | 555 | WP_005161972.1 | MltR family transcriptional regulator | - |
| EL202_RS12735 | 2678845..2679456 | - | 612 | WP_016266331.1 | LysE family translocator | - |
| EL202_RS12740 | 2679724..2681205 | + | 1482 | WP_005161967.1 | PLP-dependent aminotransferase family protein | - |
| EL202_RS12745 | 2681298..2681654 | + | 357 | WP_005161962.1 | YibL family ribosome-associated protein | - |
| EL202_RS12750 | 2681786..2682013 | + | 228 | WP_005161959.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EL202_RS12755 | 2682010..2682429 | + | 420 | WP_005161957.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL202_RS12760 | 2682583..2683254 | - | 672 | WP_014609259.1 | 6-N-hydroxylaminopurine resistance protein | - |
| EL202_RS12765 | 2683333..2685282 | - | 1950 | WP_005161951.1 | methyl-accepting chemotaxis protein | - |
| EL202_RS12770 | 2685606..2686229 | - | 624 | WP_005161946.1 | superoxide dismutase [Mn] | - |
| EL202_RS12775 | 2686356..2687210 | - | 855 | WP_005178323.1 | formate dehydrogenase accessory sulfurtransferase FdhD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15582.17 Da Isoelectric Point: 9.0596
>T287732 WP_005161957.1 NZ_LR134335:2682010-2682429 [Yersinia enterocolitica subsp. palearctica]
MIKKLYMLDTNICSFIMRERPAELIIKLQQCIEHQNKIVVSAITYSEMRFGAIGKKASPKHNYLVDEFVKRLDAILPWDT
AAVDATTNIKVELAKQGTPIGGNDAAIAGHAVSAGAILVTNNIREFERVKKLRIEDWTQ
MIKKLYMLDTNICSFIMRERPAELIIKLQQCIEHQNKIVVSAITYSEMRFGAIGKKASPKHNYLVDEFVKRLDAILPWDT
AAVDATTNIKVELAKQGTPIGGNDAAIAGHAVSAGAILVTNNIREFERVKKLRIEDWTQ
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U7IT36 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1NFG4 |