Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1395751..1396369 | Replicon | chromosome |
| Accession | NZ_LR134335 | ||
| Organism | Yersinia enterocolitica subsp. palearctica strain NCTC13769 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | Q66DR5 |
| Locus tag | EL202_RS06775 | Protein ID | WP_002208622.1 |
| Coordinates | 1396166..1396369 (+) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | A0A7U7FKE5 |
| Locus tag | EL202_RS06770 | Protein ID | WP_005163463.1 |
| Coordinates | 1395751..1396119 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL202_RS06735 | 1391405..1391665 | + | 261 | WP_005163438.1 | type B 50S ribosomal protein L31 | - |
| EL202_RS06740 | 1391681..1391824 | + | 144 | WP_002208618.1 | type B 50S ribosomal protein L36 | - |
| EL202_RS06745 | 1391952..1392830 | - | 879 | WP_005163442.1 | metal ABC transporter substrate-binding protein | - |
| EL202_RS06750 | 1392893..1393750 | - | 858 | WP_005163445.1 | metal ABC transporter permease | - |
| EL202_RS06755 | 1393764..1394474 | - | 711 | WP_014609124.1 | ABC transporter ATP-binding protein | - |
| EL202_RS06765 | 1395240..1395593 | + | 354 | WP_005163460.1 | hypothetical protein | - |
| EL202_RS06770 | 1395751..1396119 | + | 369 | WP_005163463.1 | Hha toxicity modulator TomB | Antitoxin |
| EL202_RS06775 | 1396166..1396369 | + | 204 | WP_002208622.1 | expression modulating protein YmoA | Toxin |
| EL202_RS06785 | 1397206..1397511 | + | 306 | WP_005163466.1 | MGMT family protein | - |
| EL202_RS06790 | 1397563..1398093 | - | 531 | WP_005163468.1 | YbaY family lipoprotein | - |
| EL202_RS06795 | 1398354..1399217 | + | 864 | WP_005163474.1 | acyl-CoA thioesterase II | - |
| EL202_RS06800 | 1399331..1400620 | - | 1290 | WP_005167660.1 | ammonium transporter AmtB | - |
| EL202_RS06805 | 1400660..1400998 | - | 339 | WP_002208627.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8063.31 Da Isoelectric Point: 6.4573
>T287729 WP_002208622.1 NZ_LR134335:1396166-1396369 [Yersinia enterocolitica subsp. palearctica]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14192.90 Da Isoelectric Point: 4.3377
>AT287729 WP_005163463.1 NZ_LR134335:1395751-1396119 [Yersinia enterocolitica subsp. palearctica]
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
MDEYSPKRHDVAQLKFLCESLYDEGIATLGDSHHGWVNDPTSAVNLQLNDLIEHIASFVMSFKIKYPDDGDLSELVEEYL
DDTYTLFSSYGINDPELQRWQKTKERLFRLFSGEYICTLMKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2K5S |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MN2 | |
| AlphaFold DB | A0A7U7FKE5 |