Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) DinJ-YafQ (relBE)/YafQ-RelB
Location 27145..27690 Replicon chromosome
Accession NZ_LR134335
Organism Yersinia enterocolitica subsp. palearctica strain NCTC13769

Toxin (Protein)


Gene name yafQ Uniprot ID A0A7T9XU23
Locus tag EL202_RS00195 Protein ID WP_005161463.1
Coordinates 27412..27690 (+) Length 93 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID A0A7T9Y052
Locus tag EL202_RS00190 Protein ID WP_005161466.1
Coordinates 27145..27405 (+) Length 87 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL202_RS00155 22410..23165 + 756 Protein_29 IS21 family transposase -
EL202_RS00160 23152..23877 + 726 WP_014608996.1 IS21-like element ISYen2A/ISYen2B family helper ATPase IstB -
EL202_RS00165 24110..24248 - 139 Protein_31 ash family protein -
EL202_RS00170 24540..25424 - 885 WP_072077259.1 Rpn family recombination-promoting nuclease/putative transposase -
EL202_RS21450 25630..25806 - 177 WP_005161476.1 hypothetical protein -
EL202_RS00175 26248..26568 - 321 WP_005161473.1 hypothetical protein -
EL202_RS00180 26558..26764 - 207 WP_005161471.1 hypothetical protein -
EL202_RS00185 26906..27073 + 168 WP_005161469.1 hypothetical protein -
EL202_RS00190 27145..27405 + 261 WP_005161466.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
EL202_RS00195 27412..27690 + 279 WP_005161463.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family Toxin
EL202_RS00200 27743..28355 - 613 Protein_39 tail fiber assembly protein -
EL202_RS00205 28355..29647 - 1293 WP_014608992.1 phage tail protein -
EL202_RS21455 29620..29901 - 282 WP_005161459.1 phage tail protein -
EL202_RS00210 29898..30440 - 543 WP_005161456.1 phage tail protein I -
EL202_RS00215 30433..31341 - 909 WP_005178623.1 baseplate assembly protein -
EL202_RS00220 31341..31697 - 357 WP_005161449.1 GPW/gp25 family protein -
EL202_RS00225 31694..32329 - 636 WP_005161446.1 phage baseplate assembly protein V -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - pilW 359..57647 57288


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(4-92)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-85)


Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 11002.70 Da        Isoelectric Point: 9.6243

>T287724 WP_005161463.1 NZ_LR134335:27412-27690 [Yersinia enterocolitica subsp. palearctica]
MTKQREIEYSGQFQKDVKKAQKRHKDINKLKTIMALLIDDKLPLPVIYKDHQLQGNYKGYRDAHIEPDWLIIYKITDDLL
RFERTGSHSDLF

Download         Length: 279 bp

Antitoxin


Download         Length: 87 a.a.        Molecular weight: 9277.75 Da        Isoelectric Point: 7.0134

>AT287724 WP_005161466.1 NZ_LR134335:27145-27405 [Yersinia enterocolitica subsp. palearctica]
MAANAFVRARIDETLKNEAAAVLAGMGLTVSDLVRITLTKVAREKALPFDLRIPNELTAKTIANSEKGVDVHKAKDADDL
FDKLGI

Download         Length: 261 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7T9XU23

Antitoxin

Source ID Structure
AlphaFold DB A0A7T9Y052

References