Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1665619..1666211 Replicon chromosome
Accession NZ_LR134321
Organism Shewanella baltica strain NCTC10737

Toxin (Protein)


Gene name hicA Uniprot ID A0A252ENI2
Locus tag EL185_RS07245 Protein ID WP_014610888.1
Coordinates 1665957..1666211 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A252ENK1
Locus tag EL185_RS07240 Protein ID WP_014610929.1
Coordinates 1665619..1665960 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL185_RS07200 1661195..1661278 + 84 WP_126493479.1 hypothetical protein -
EL185_RS07210 1661674..1662090 - 417 WP_088585313.1 DUF86 domain-containing protein -
EL185_RS07215 1662083..1662505 - 423 WP_126491558.1 nucleotidyltransferase domain-containing protein -
EL185_RS07220 1662794..1663039 + 246 WP_014610893.1 type II toxin-antitoxin system CcdA family antitoxin -
EL185_RS07225 1663039..1663356 + 318 WP_126491578.1 CcdB family protein -
EL185_RS07230 1663711..1665078 + 1368 WP_014610930.1 HipA domain-containing protein -
EL185_RS07235 1665075..1665455 + 381 WP_086904820.1 helix-turn-helix domain-containing protein -
EL185_RS07240 1665619..1665960 - 342 WP_014610929.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
EL185_RS07245 1665957..1666211 - 255 WP_014610888.1 type II toxin-antitoxin system HicA family toxin Toxin
EL185_RS07250 1666611..1667222 - 612 WP_126491579.1 mobile mystery protein B -
EL185_RS07255 1667219..1667707 - 489 WP_069453178.1 mobile mystery protein A -
EL185_RS07260 1667912..1668289 + 378 Protein_1399 transposase -
EL185_RS07265 1668845..1669858 + 1014 WP_126491580.1 dTDP-glucose 4,6-dehydratase -
EL185_RS07270 1669930..1670106 + 177 WP_197721152.1 tyrosine-type recombinase/integrase -
EL185_RS21695 1670184..1670348 - 165 WP_014610884.1 hypothetical protein -
EL185_RS07275 1670370..1670771 - 402 Protein_1403 zeta toxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1667840..1668289 449


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-75)

Antitoxin

Uncharacterised protein family HicB

(55-104)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9480.99 Da        Isoelectric Point: 10.1453

>T287672 WP_014610888.1 NZ_LR134321:c1666211-1665957 [Shewanella baltica]
MNKKHLRTLTAIFARPVSGAIKWSDIEALFIALGADIEEREGSRIGVVLFGEVQVYHRPHPQKETDKDAVISIKKWLERN
GVKA

Download         Length: 255 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12379.91 Da        Isoelectric Point: 4.3992

>AT287672 WP_014610929.1 NZ_LR134321:c1665960-1665619 [Shewanella baltica]
MKNLMMINGVKAFIDYDPDAETFRGEFVGLNGGADFYGESVAQLEAEGAKSLSVFLEMCQERGIEPYKNFSGKFNVRISP
EVHARLNEIALSQSISLNAAVENAVNDYIAHSA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A252ENI2

Antitoxin

Source ID Structure
AlphaFold DB A0A252ENK1

References