Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE(toxin)
Location 922844..923331 Replicon chromosome
Accession NZ_LR134317
Organism Streptococcus equi subsp. zooepidemicus strain NCTC6180

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag EL136_RS04450 Protein ID WP_138119189.1
Coordinates 922844..923101 (-) Length 86 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag EL136_RS04455 Protein ID WP_138119187.1
Coordinates 923098..923331 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL136_RS04425 918070..918639 - 570 WP_138119199.1 DUF4355 domain-containing protein -
EL136_RS04430 918967..919875 - 909 WP_138119197.1 minor capsid protein -
EL136_RS04435 919868..921169 - 1302 WP_138119195.1 phage portal protein -
EL136_RS04440 921169..922443 - 1275 WP_138119193.1 PBSX family phage terminase large subunit -
EL136_RS04445 922433..922771 - 339 WP_138119191.1 hypothetical protein -
EL136_RS04450 922844..923101 - 258 WP_138119189.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EL136_RS04455 923098..923331 - 234 WP_138119187.1 antitoxin Antitoxin
EL136_RS04460 923501..923938 - 438 WP_138119185.1 DUF1492 domain-containing protein -
EL136_RS04465 924130..924465 - 336 WP_154803896.1 hypothetical protein -
EL136_RS04475 924829..925341 - 513 WP_138119179.1 crossover junction endodeoxyribonuclease RuvC -
EL136_RS04480 925338..925679 - 342 WP_003052428.1 hypothetical protein -
EL136_RS04485 925857..926654 - 798 WP_154803897.1 PD-(D/E)XK nuclease-like domain-containing protein -
EL136_RS04490 926651..927571 - 921 WP_154803898.1 recombinase RecT -
EL136_RS04495 927627..927833 - 207 WP_154803899.1 hypothetical protein -
EL136_RS04500 927870..928103 - 234 WP_154803900.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 888696..935240 46544


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-84)

Antitoxin

Protein of unknown function DUF6290

(1-57)


Sequences

Toxin        


Download         Length: 86 a.a.        Molecular weight: 9926.74 Da        Isoelectric Point: 10.6548

>T287658 WP_138119189.1 NZ_LR134317:c923101-922844 [Streptococcus equi subsp. zooepidemicus]
MSYKLIPTPLFAKQFKKLDKFVQKQIKSYLEKVLSDPRAKGKGLVANRSGQWRYRIGDYRVIVNIQDGEMIVLALEVGHR
KDIYK

Download         Length: 258 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8731.96 Da        Isoelectric Point: 4.1196

>AT287658 WP_138119187.1 NZ_LR134317:c923331-923098 [Streptococcus equi subsp. zooepidemicus]
MAVITLKISEQEKSFLQGMAKFEGISLSELIRKKTLKSLEDEYDARVADMALEDYENYLENGGQVLSWAALMNEVDL

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References