Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 6555500..6556095 | Replicon | chromosome |
| Accession | NZ_LR134308 | ||
| Organism | Pseudomonas aeruginosa strain NCTC11445 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL295_RS31775 | Protein ID | WP_071537327.1 |
| Coordinates | 6555500..6555778 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | EL295_RS31780 | Protein ID | WP_003113527.1 |
| Coordinates | 6555790..6556095 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL295_RS31755 | 6550926..6552164 | + | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
| EL295_RS31760 | 6552226..6552873 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| EL295_RS31765 | 6552943..6555171 | - | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| EL295_RS31775 | 6555500..6555778 | + | 279 | WP_071537327.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL295_RS31780 | 6555790..6556095 | + | 306 | WP_003113527.1 | HigA family addiction module antidote protein | Antitoxin |
| EL295_RS31790 | 6556501..6557601 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| EL295_RS31795 | 6557642..6558226 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| EL295_RS31800 | 6558268..6558882 | - | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| EL295_RS31805 | 6558999..6559940 | - | 942 | WP_124135336.1 | ribose-phosphate pyrophosphokinase | - |
| EL295_RS31815 | 6560107..6560955 | - | 849 | WP_126453433.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T287582 WP_071537327.1 NZ_LR134308:6555500-6555778 [Pseudomonas aeruginosa]
MILTFRCDEARQLFETGLSRRWGAILTVATRKLTMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDEARQLFETGLSRRWGAILTVATRKLTMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|