Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 502756..503437 | Replicon | chromosome |
| Accession | NZ_LR134308 | ||
| Organism | Pseudomonas aeruginosa strain NCTC11445 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6AKP0 |
| Locus tag | EL295_RS02390 | Protein ID | WP_003111825.1 |
| Coordinates | 502756..503121 (+) | Length | 122 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1C7BMJ2 |
| Locus tag | EL295_RS02395 | Protein ID | WP_003159602.1 |
| Coordinates | 503114..503437 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL295_RS02360 | 498737..499171 | - | 435 | WP_003116494.1 | RidA family protein | - |
| EL295_RS02365 | 499392..500345 | + | 954 | WP_003085661.1 | LysR family transcriptional regulator | - |
| EL295_RS02370 | 500318..501202 | - | 885 | WP_033974362.1 | LysR family transcriptional regulator | - |
| EL295_RS02375 | 501303..501728 | + | 426 | WP_003114206.1 | ring-cleaving dioxygenase | - |
| EL295_RS02380 | 501747..502019 | - | 273 | WP_003085667.1 | hypothetical protein | - |
| EL295_RS02385 | 502226..502465 | + | 240 | WP_049876884.1 | hypothetical protein | - |
| EL295_RS02390 | 502756..503121 | + | 366 | WP_003111825.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL295_RS02395 | 503114..503437 | + | 324 | WP_003159602.1 | XRE family transcriptional regulator | Antitoxin |
| EL295_RS02400 | 503813..504901 | - | 1089 | WP_003145732.1 | DUF3396 domain-containing protein | - |
| EL295_RS02405 | 504918..505619 | - | 702 | WP_033974360.1 | VRR-NUC domain-containing protein | - |
| EL295_RS02410 | 505616..506134 | - | 519 | WP_010793873.1 | PAAR domain-containing protein | - |
| EL295_RS02415 | 506308..506643 | - | 336 | WP_003119438.1 | TM2 domain-containing protein | - |
| EL295_RS02420 | 506886..507524 | - | 639 | WP_003145727.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 501303..559354 | 58051 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13880.24 Da Isoelectric Point: 4.8219
>T287575 WP_003111825.1 NZ_LR134308:502756-503121 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6AKP0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1C7BMJ2 |