Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 6891..7477 | Replicon | chromosome |
| Accession | NZ_LR134308 | ||
| Organism | Pseudomonas aeruginosa strain NCTC11445 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | G8CP73 |
| Locus tag | EL295_RS00035 | Protein ID | WP_003120987.1 |
| Coordinates | 6891..7190 (+) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | - |
| Locus tag | EL295_RS00040 | Protein ID | WP_003448662.1 |
| Coordinates | 7187..7477 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL295_RS00035 | 6891..7190 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL295_RS00040 | 7187..7477 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
| EL295_RS00045 | 7560..7892 | - | 333 | WP_031640358.1 | hypothetical protein | - |
| EL295_RS00050 | 8033..10009 | - | 1977 | WP_126452961.1 | DEAD/DEAH box helicase | - |
| EL295_RS00055 | 10006..11895 | - | 1890 | WP_126452964.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T287574 WP_003120987.1 NZ_LR134308:6891-7190 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|