Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4630019..4630854 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | E3PD61 |
| Locus tag | EL138_RS22960 | Protein ID | WP_001094449.1 |
| Coordinates | 4630477..4630854 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A2A3V5X4 |
| Locus tag | EL138_RS22955 | Protein ID | WP_001280917.1 |
| Coordinates | 4630019..4630387 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS22920 | 4626744..4627199 | + | 456 | WP_000581502.1 | hypothetical protein | - |
| EL138_RS22925 | 4627278..4627511 | + | 234 | WP_073520517.1 | DUF905 family protein | - |
| EL138_RS25605 | 4627611..4627889 | + | 279 | Protein_4383 | DUF932 domain-containing protein | - |
| EL138_RS25610 | 4628091..4628564 | + | 474 | WP_000855059.1 | antirestriction protein | - |
| EL138_RS22940 | 4628580..4629056 | + | 477 | WP_001186771.1 | RadC family protein | - |
| EL138_RS22945 | 4629119..4629340 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| EL138_RS22950 | 4629359..4630003 | + | 645 | WP_089585986.1 | antitoxin of toxin-antitoxin stability system | - |
| EL138_RS22955 | 4630019..4630387 | + | 369 | WP_001280917.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL138_RS22960 | 4630477..4630854 | + | 378 | WP_001094449.1 | TA system toxin CbtA family protein | Toxin |
| EL138_RS22965 | 4630851..4631021 | + | 171 | Protein_4390 | hypothetical protein | - |
| EL138_RS22970 | 4631076..4631273 | + | 198 | WP_087891818.1 | DUF957 domain-containing protein | - |
| EL138_RS22975 | 4631358..4632203 | + | 846 | WP_001290175.1 | DUF4942 domain-containing protein | - |
| EL138_RS22980 | 4632274..4633809 | + | 1536 | WP_000492893.1 | EAL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4575974..4643963 | 67989 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14162.00 Da Isoelectric Point: 6.6312
>T287303 WP_001094449.1 NZ_LR134237:4630477-4630854 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SSCTHSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SSCTHSQLINSIDILRARRATGLMTRDNYRTVNDITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13794.67 Da Isoelectric Point: 5.8808
>AT287303 WP_001280917.1 NZ_LR134237:4630019-4630387 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLICEADTLGSCGYVYLAVYPTPEMKN
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLICEADTLGSCGYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PD61 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A3V5X4 |