Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3113374..3114175 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | EL138_RS15570 | Protein ID | WP_000854739.1 |
| Coordinates | 3113374..3113754 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | EL138_RS15575 | Protein ID | WP_001285482.1 |
| Coordinates | 3113801..3114175 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS15535 | 3108965..3109519 | - | 555 | WP_001001909.1 | molecular chaperone YcdY | - |
| EL138_RS15540 | 3109543..3110280 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| EL138_RS15545 | 3110335..3111273 | - | 939 | WP_000351293.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| EL138_RS15555 | 3111760..3112587 | - | 828 | WP_001304477.1 | DUF4942 domain-containing protein | - |
| EL138_RS15560 | 3112672..3112869 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| EL138_RS15565 | 3112889..3113377 | - | 489 | WP_001054232.1 | hypothetical protein | - |
| EL138_RS15570 | 3113374..3113754 | - | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| EL138_RS15575 | 3113801..3114175 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL138_RS15580 | 3114225..3114869 | - | 645 | WP_001533142.1 | hypothetical protein | - |
| EL138_RS15585 | 3114888..3115109 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| EL138_RS15590 | 3115172..3115648 | - | 477 | WP_001186170.1 | RadC family protein | - |
| EL138_RS15595 | 3115664..3116137 | - | 474 | WP_000855076.1 | antirestriction protein | - |
| EL138_RS15600 | 3116400..3117221 | - | 822 | WP_001234710.1 | DUF945 domain-containing protein | - |
| EL138_RS25670 | 3117302..3117513 | + | 212 | Protein_3000 | hypothetical protein | - |
| EL138_RS15610 | 3117632..3118087 | - | 456 | WP_000581502.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T287294 WP_000854739.1 NZ_LR134237:c3113754-3113374 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT287294 WP_001285482.1 NZ_LR134237:c3114175-3113801 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V687 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7R0L9 |