Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1997766..1998597 Replicon chromosome
Accession NZ_LR134237
Organism Escherichia coli strain NCTC9022

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag EL138_RS09705 Protein ID WP_000854814.1
Coordinates 1997766..1998140 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1PWQ3
Locus tag EL138_RS09710 Protein ID WP_001285586.1
Coordinates 1998229..1998597 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL138_RS09665 1993162..1994328 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
EL138_RS09670 1994447..1994920 + 474 WP_126299436.1 DNA gyrase inhibitor SbmC -
EL138_RS09675 1995118..1996176 + 1059 WP_001200890.1 FUSC family protein -
EL138_RS09680 1996348..1996677 + 330 WP_000450409.1 DUF496 family protein -
EL138_RS09685 1996778..1996960 - 183 WP_001016348.1 hypothetical protein -
EL138_RS09690 1997014..1997160 + 147 Protein_1866 transposase domain-containing protein -
EL138_RS09695 1997449..1997562 - 114 WP_001161660.1 DUF957 domain-containing protein -
EL138_RS09700 1997575..1997769 - 195 WP_000988601.1 hypothetical protein -
EL138_RS09705 1997766..1998140 - 375 WP_000854814.1 type IV toxin-antitoxin system toxin CbtA Toxin
EL138_RS09710 1998229..1998597 - 369 WP_001285586.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
EL138_RS09715 1998671..1998892 - 222 WP_000692323.1 DUF987 domain-containing protein -
EL138_RS09720 1998961..1999437 - 477 WP_001351157.1 RadC family protein -
EL138_RS09725 1999453..1999926 - 474 WP_000855074.1 antirestriction protein -
EL138_RS09730 2000189..2001010 - 822 WP_001234571.1 DUF945 domain-containing protein -
EL138_RS09740 2001231..2001641 - 411 WP_000846704.1 hypothetical protein -
EL138_RS09745 2001657..2002334 - 678 WP_001362823.1 hypothetical protein -
EL138_RS09750 2002470..2003540 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T287288 WP_000854814.1 NZ_LR134237:c1998140-1997766 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13563.41 Da        Isoelectric Point: 5.0468

>AT287288 WP_001285586.1 NZ_LR134237:c1998597-1998229 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELSPRYQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB S1PWQ3

References