Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 46923..47714 | Replicon | chromosome |
| Accession | NZ_LR134237 | ||
| Organism | Escherichia coli strain NCTC9022 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | EL138_RS00240 | Protein ID | WP_000691791.1 |
| Coordinates | 46923..47348 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3L1KVZ6 |
| Locus tag | EL138_RS00245 | Protein ID | WP_000939437.1 |
| Coordinates | 47379..47714 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL138_RS00210 | 42589..43086 | - | 498 | WP_000509808.1 | hypothetical protein | - |
| EL138_RS00220 | 43768..44154 | - | 387 | WP_001270938.1 | DUF2441 domain-containing protein | - |
| EL138_RS00225 | 44777..45508 | - | 732 | WP_001216639.1 | TIGR02646 family protein | - |
| EL138_RS00230 | 45505..45726 | - | 222 | WP_126125326.1 | hypothetical protein | - |
| EL138_RS00235 | 45711..46902 | - | 1192 | Protein_45 | AAA family ATPase | - |
| EL138_RS00240 | 46923..47348 | - | 426 | WP_000691791.1 | TA system toxin CbtA family protein | Toxin |
| EL138_RS00245 | 47379..47714 | - | 336 | WP_000939437.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL138_RS00250 | 47714..48187 | - | 474 | WP_001292742.1 | DNA repair protein RadC | - |
| EL138_RS00255 | 48217..49035 | - | 819 | WP_000761990.1 | DUF945 domain-containing protein | - |
| EL138_RS00260 | 49271..50224 | - | 954 | WP_000290406.1 | hypothetical protein | - |
| EL138_RS00265 | 50817..51431 | + | 615 | WP_000772910.1 | inovirus Gp2 family protein | - |
| EL138_RS00270 | 51549..51767 | + | 219 | WP_000070772.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 44777..68712 | 23935 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16490.11 Da Isoelectric Point: 10.2376
>T287283 WP_000691791.1 NZ_LR134237:c47348-46923 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVNAVNFLVEKYELVRIDRKGF
SWQEQTPYLRAVDILRARQATGLRIQCKNTNIISRMADSRHDKRLYQRTFKACKRCYYTKT
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVNAVNFLVEKYELVRIDRKGF
SWQEQTPYLRAVDILRARQATGLRIQCKNTNIISRMADSRHDKRLYQRTFKACKRCYYTKT
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|