Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2226497..2227151 | Replicon | chromosome |
| Accession | NZ_LR134234 | ||
| Organism | Escherichia coli strain NCTC8623 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | EL131_RS10935 | Protein ID | WP_000244781.1 |
| Coordinates | 2226497..2226904 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | EL131_RS10940 | Protein ID | WP_000354046.1 |
| Coordinates | 2226885..2227151 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL131_RS10915 | 2222454..2224187 | - | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| EL131_RS10920 | 2224193..2224903 | - | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL131_RS10925 | 2224928..2225824 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| EL131_RS10930 | 2225936..2226457 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| EL131_RS10935 | 2226497..2226904 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| EL131_RS10940 | 2226885..2227151 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| EL131_RS10945 | 2227394..2228374 | + | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
| EL131_RS10950 | 2228570..2229229 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| EL131_RS10955 | 2229393..2229704 | - | 312 | WP_001182944.1 | N(4)-acetylcytidine aminohydrolase | - |
| EL131_RS10960 | 2229749..2231182 | + | 1434 | WP_024186065.1 | 6-phospho-beta-glucosidase BglA | - |
| EL131_RS10965 | 2231239..2231982 | - | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T287238 WP_000244781.1 NZ_LR134234:c2226904-2226497 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|