Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 828769..829604 | Replicon | chromosome |
| Accession | NZ_LR134228 | ||
| Organism | Escherichia coli strain NCTC9699 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A7W4PV54 |
| Locus tag | EL118_RS04025 | Protein ID | WP_000854821.1 |
| Coordinates | 828769..829146 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A4Q1HU91 |
| Locus tag | EL118_RS04030 | Protein ID | WP_053287563.1 |
| Coordinates | 829236..829604 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL118_RS03995 | 823850..824449 | + | 600 | WP_001255034.1 | type II secretion system minor pseudopilin GspJ | - |
| EL118_RS04000 | 824452..825429 | + | 978 | WP_001460058.1 | type II secretion system minor pseudopilin GspK | - |
| EL118_RS04005 | 825426..826604 | + | 1179 | WP_000094986.1 | type II secretion system protein GspL | - |
| EL118_RS04010 | 826606..827142 | + | 537 | WP_000942785.1 | GspM family type II secretion system protein YghD | - |
| EL118_RS04015 | 827423..828265 | - | 843 | WP_071701699.1 | DUF4942 domain-containing protein | - |
| EL118_RS04020 | 828350..828547 | - | 198 | WP_023563519.1 | DUF957 domain-containing protein | - |
| EL118_RS04025 | 828769..829146 | - | 378 | WP_000854821.1 | type IV toxin-antitoxin system toxin CbtA | Toxin |
| EL118_RS04030 | 829236..829604 | - | 369 | WP_053287563.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EL118_RS04035 | 829684..829905 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| EL118_RS04040 | 829974..830450 | - | 477 | WP_001186747.1 | RadC family protein | - |
| EL118_RS04045 | 830465..830950 | - | 486 | WP_126509144.1 | antirestriction protein | - |
| EL118_RS04050 | 831042..831639 | - | 598 | Protein_791 | DUF932 domain-containing protein | - |
| EL118_RS04060 | 831860..832270 | - | 411 | WP_000846713.1 | hypothetical protein | - |
| EL118_RS04065 | 832286..832969 | - | 684 | WP_000775505.1 | hypothetical protein | - |
| EL118_RS04070 | 833105..834175 | - | 1071 | WP_000102627.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T287189 WP_000854821.1 NZ_LR134228:c829146-828769 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13663.36 Da Isoelectric Point: 6.4768
>AT287189 WP_053287563.1 NZ_LR134228:c829604-829236 [Escherichia coli]
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNSRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
VSDTFSGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADSYHLDQAFPLLMKQLELMLTSG
ELNSRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7W4PV54 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4Q1HU91 |