Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3751767..3752554 Replicon chromosome
Accession NZ_LR134220
Organism Escherichia coli strain NCTC11121

Toxin (Protein)


Gene name yeeV Uniprot ID A0A377E3D6
Locus tag EL088_RS18505 Protein ID WP_001194695.1
Coordinates 3752177..3752554 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag EL088_RS18500 Protein ID WP_040207079.1
Coordinates 3751767..3752126 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL088_RS18455 3747456..3748091 + 636 WP_040220404.1 hypothetical protein -
EL088_RS18460 3748127..3748579 + 453 WP_001020418.1 hypothetical protein -
EL088_RS18465 3748576..3749025 + 450 WP_040220400.1 hypothetical protein -
EL088_RS18470 3749102..3749335 + 234 WP_111724753.1 DUF905 domain-containing protein -
EL088_RS18475 3749455..3750273 + 819 WP_001234406.1 DUF945 domain-containing protein -
EL088_RS18485 3750540..3751010 + 471 WP_000131762.1 antirestriction protein -
EL088_RS18490 3751022..3751501 + 480 WP_000437750.1 DNA repair protein RadC -
EL088_RS18495 3751522..3751743 + 222 WP_000691981.1 DUF987 domain-containing protein -
EL088_RS18500 3751767..3752126 + 360 WP_040207079.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EL088_RS18505 3752177..3752554 + 378 WP_001194695.1 TA system toxin CbtA family protein Toxin
EL088_RS18510 3752551..3753042 + 492 WP_040220390.1 hypothetical protein -
EL088_RS18515 3753074..3753277 + 204 WP_000413747.1 DUF957 domain-containing protein -
EL088_RS18520 3753358..3754209 + 852 WP_001614353.1 DUF4942 domain-containing protein -
EL088_RS18530 3754540..3755271 - 732 WP_001340895.1 DNA polymerase III subunit epsilon -
EL088_RS18535 3755336..3755803 + 468 WP_000917883.1 ribonuclease HI -
EL088_RS18540 3755800..3756522 - 723 WP_001326702.1 class I SAM-dependent methyltransferase -
EL088_RS18545 3756556..3757311 + 756 WP_001052715.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14180.97 Da        Isoelectric Point: 7.4209

>T287120 WP_001194695.1 NZ_LR134220:3752177-3752554 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13112.99 Da        Isoelectric Point: 7.0259

>AT287120 WP_040207079.1 NZ_LR134220:3751767-3752126 [Escherichia coli]
MSNKIPTVNHDITDPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A377E3D6

Antitoxin

Source ID Structure

References