Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 675736..675997 | Replicon | chromosome |
| Accession | NZ_LR134215 | ||
| Organism | Shimwellia blattae strain NCTC12127 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | EL083_RS03215 | Protein ID | WP_071840846.1 |
| Coordinates | 675836..675997 (+) | Length | 54 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 675736..675772 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL083_RS03185 | 670864..671154 | + | 291 | WP_002444900.1 | citrate lyase acyl carrier protein | - |
| EL083_RS03190 | 671151..672026 | + | 876 | WP_002444902.1 | citrate (pro-3S)-lyase subunit beta | - |
| EL083_RS03195 | 672037..673554 | + | 1518 | WP_002444904.1 | citrate lyase subunit alpha | - |
| EL083_RS03200 | 673559..674098 | + | 540 | WP_002444905.1 | citrate lyase holo-[acyl-carrier protein] synthase | - |
| EL083_RS03205 | 674076..674933 | + | 858 | WP_002444907.1 | triphosphoribosyl-dephospho-CoA synthase CitG | - |
| EL083_RS03210 | 675268..675429 | + | 162 | WP_014715816.1 | Hok/Gef family protein | - |
| - | 675736..675772 | - | 37 | - | - | Antitoxin |
| EL083_RS03215 | 675836..675997 | + | 162 | WP_071840846.1 | Hok/Gef family protein | Toxin |
| EL083_RS03220 | 676115..677200 | - | 1086 | WP_002444912.1 | membrane-bound lytic murein transglycosylase MltC | - |
| EL083_RS03225 | 677300..677572 | - | 273 | WP_002444915.1 | oxidative damage protection protein | - |
| EL083_RS03230 | 677575..678657 | - | 1083 | WP_002444917.1 | A/G-specific adenine glycosylase | - |
| EL083_RS03235 | 678814..679533 | + | 720 | WP_002444919.1 | tRNA (guanosine(46)-N7)-methyltransferase TrmB | - |
| EL083_RS03240 | 679533..679859 | + | 327 | WP_002444921.1 | YggL family protein | - |
| EL083_RS03245 | 679918..680634 | + | 717 | WP_002444923.1 | DUF2884 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 5825.18 Da Isoelectric Point: 7.6415
>T287073 WP_071840846.1 NZ_LR134215:675836-675997 [Shimwellia blattae]
MKLSQNSAVWCLLIVCLTLLLLTLIIHPRLCEIRVTMGSREIAAIMACGVEPS
MKLSQNSAVWCLLIVCLTLLLLTLIIHPRLCEIRVTMGSREIAAIMACGVEPS
Download Length: 162 bp
Antitoxin
Download Length: 37 bp
>AT287073 NZ_LR134215:c675772-675736 [Shimwellia blattae]
GGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|