Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 1516200..1516900 | Replicon | chromosome |
| Accession | NZ_LR134189 | ||
| Organism | Providencia rustigianii strain NCTC6933 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | EL059_RS06900 | Protein ID | WP_126436699.1 |
| Coordinates | 1516200..1516571 (+) | Length | 124 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D1NZL2 |
| Locus tag | EL059_RS06905 | Protein ID | WP_006813433.1 |
| Coordinates | 1516580..1516900 (+) | Length | 107 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL059_RS06880 | 1511419..1512045 | + | 627 | WP_164717602.1 | protein phosphatase CheZ | - |
| EL059_RS06885 | 1512197..1512545 | - | 349 | Protein_1327 | HNH nuclease YajD | - |
| EL059_RS06890 | 1512817..1513967 | + | 1151 | Protein_1328 | flagellar type III secretion system protein FlhB | - |
| EL059_RS06895 | 1513960..1516058 | + | 2099 | Protein_1329 | flagellar biosynthesis protein FlhA | - |
| EL059_RS06900 | 1516200..1516571 | + | 372 | WP_126436699.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL059_RS06905 | 1516580..1516900 | + | 321 | WP_006813433.1 | helix-turn-helix domain-containing protein | Antitoxin |
| EL059_RS06910 | 1516938..1517378 | - | 441 | WP_006813432.1 | flagellar export chaperone FlgN | - |
| EL059_RS06915 | 1517390..1517693 | - | 304 | Protein_1333 | anti-sigma-28 factor FlgM | - |
| EL059_RS06920 | 1517904..1518571 | - | 668 | Protein_1334 | flagellar basal body P-ring formation protein FlgA | - |
| EL059_RS06925 | 1518803..1519216 | + | 414 | WP_126436701.1 | flagellar basal body rod protein FlgB | - |
| EL059_RS06930 | 1519222..1519626 | + | 405 | WP_006813426.1 | flagellar basal body rod protein FlgC | - |
| EL059_RS06935 | 1519639..1520496 | + | 858 | WP_115164158.1 | flagellar basal-body rod modification protein | - |
| EL059_RS06940 | 1520527..1521795 | + | 1269 | WP_006813424.1 | flagellar hook protein FlgE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13962.41 Da Isoelectric Point: 10.2396
>T286968 WP_126436699.1 NZ_LR134189:1516200-1516571 [Providencia rustigianii]
MAIYKTKIFKSKLKKLELDEIDVLLAAKQVLSGCYEADLGGGVIKKRLAIQGFGKRAGIRTIIFYKQGSHLFFADGWSKS
RLASKGRKEIEDDDLESYKDIARILLNSDPIKIAHMLKNWLFN
MAIYKTKIFKSKLKKLELDEIDVLLAAKQVLSGCYEADLGGGVIKKRLAIQGFGKRAGIRTIIFYKQGSHLFFADGWSKS
RLASKGRKEIEDDDLESYKDIARILLNSDPIKIAHMLKNWLFN
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|