Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 4221081..4221745 | Replicon | chromosome |
| Accession | NZ_LR134151 | ||
| Organism | Serratia plymuthica strain NCTC8900 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | EL066_RS20140 | Protein ID | WP_126484896.1 |
| Coordinates | 4221081..4221437 (+) | Length | 119 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2X4V2M0 |
| Locus tag | EL066_RS20145 | Protein ID | WP_063200237.1 |
| Coordinates | 4221443..4221745 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL066_RS20125 | 4218309..4219328 | + | 1020 | WP_004952299.1 | HTH-type transcriptional regulator GalR | - |
| EL066_RS20130 | 4219325..4219781 | - | 457 | Protein_3888 | GNAT family N-acetyltransferase | - |
| EL066_RS20135 | 4219933..4220942 | + | 1010 | Protein_3889 | LacI family DNA-binding transcriptional regulator | - |
| EL066_RS20140 | 4221081..4221437 | + | 357 | WP_126484896.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EL066_RS20145 | 4221443..4221745 | + | 303 | WP_063200237.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| EL066_RS20150 | 4221775..4223037 | - | 1263 | WP_126484898.1 | diaminopimelate decarboxylase | - |
| EL066_RS20155 | 4223174..4224097 | + | 924 | WP_126484900.1 | LysR family transcriptional regulator | - |
| EL066_RS20160 | 4224087..4225241 | - | 1155 | WP_126484902.1 | MFS transporter | - |
| EL066_RS20165 | 4225557..4226465 | - | 909 | WP_126484904.1 | LysR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 119 a.a. Molecular weight: 13805.86 Da Isoelectric Point: 9.7192
>T286874 WP_126484896.1 NZ_LR134151:4221081-4221437 [Serratia plymuthica]
MWQVITVERFDDWFLSLNDDEQKSLLAGIFKLQEFGPLLARPHADTLHFSGSIRHLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKTGDKRFYQRLLPIAAMEFSHYLATQR
MWQVITVERFDDWFLSLNDDEQKSLLAGIFKLQEFGPLLARPHADTLHFSGSIRHLKELRIQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKTGDKRFYQRLLPIAAMEFSHYLATQR
Download Length: 357 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|