Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 3107971..3108602 | Replicon | chromosome |
| Accession | NZ_LR134151 | ||
| Organism | Serratia plymuthica strain NCTC8900 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | EL066_RS14960 | Protein ID | WP_126483482.1 |
| Coordinates | 3107971..3108369 (-) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | EL066_RS14965 | Protein ID | WP_126483484.1 |
| Coordinates | 3108369..3108602 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL066_RS14935 | 3103489..3103875 | + | 387 | WP_197718809.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| EL066_RS14940 | 3103856..3104158 | + | 303 | WP_126483474.1 | transcriptional regulator | - |
| EL066_RS14945 | 3104216..3104620 | - | 405 | WP_126483476.1 | flagellar protein FlhE | - |
| EL066_RS14950 | 3104620..3106698 | - | 2079 | WP_126483478.1 | flagellar biosynthesis protein FlhA | - |
| EL066_RS14955 | 3106691..3107842 | - | 1152 | WP_126483480.1 | flagellar type III secretion system protein FlhB | - |
| EL066_RS14960 | 3107971..3108369 | - | 399 | WP_126483482.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EL066_RS14965 | 3108369..3108602 | - | 234 | WP_126483484.1 | antitoxin | Antitoxin |
| EL066_RS14970 | 3108726..3109370 | - | 645 | WP_126483486.1 | protein phosphatase CheZ | - |
| EL066_RS14975 | 3109381..3109770 | - | 390 | WP_006321484.1 | chemotaxis response regulator CheY | - |
| EL066_RS14980 | 3109991..3111040 | - | 1050 | WP_126483488.1 | chemotaxis response regulator protein-glutamate methylesterase | - |
| EL066_RS14985 | 3111040..3111912 | - | 873 | WP_126483490.1 | protein-glutamate O-methyltransferase CheR | - |
| EL066_RS14990 | 3111941..3113566 | - | 1626 | WP_126483492.1 | Tar ligand binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14852.98 Da Isoelectric Point: 7.5219
>T286869 WP_126483482.1 NZ_LR134151:c3108369-3107971 [Serratia plymuthica]
MFSHMLDTNIVIYVIKRRPIEVLSKFNQHAGKMVISSVTYAELIHGVEKSARPTENARVVDDFVSRLEILDYSAKAAAHY
GNIRASLEQQGTPIGVNDLHIAGHARSEGLVLVTNNLREFERVDGLRLQNWL
MFSHMLDTNIVIYVIKRRPIEVLSKFNQHAGKMVISSVTYAELIHGVEKSARPTENARVVDDFVSRLEILDYSAKAAAHY
GNIRASLEQQGTPIGVNDLHIAGHARSEGLVLVTNNLREFERVDGLRLQNWL
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|