Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3067225..3067850 | Replicon | chromosome |
| Accession | NZ_LR134151 | ||
| Organism | Serratia plymuthica strain NCTC8900 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | EL066_RS14720 | Protein ID | WP_006321377.1 |
| Coordinates | 3067225..3067407 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | EL066_RS14725 | Protein ID | WP_126483414.1 |
| Coordinates | 3067437..3067850 (+) | Length | 138 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL066_RS14715 | 3063087..3067058 | + | 3972 | WP_126483413.1 | trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase | - |
| EL066_RS14720 | 3067225..3067407 | + | 183 | WP_006321377.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| EL066_RS14725 | 3067437..3067850 | + | 414 | WP_126483414.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| EL066_RS14730 | 3067885..3068637 | - | 753 | WP_062871168.1 | L-cystine ABC transporter ATP-binding protein YecC | - |
| EL066_RS14735 | 3068641..3069302 | - | 662 | Protein_2848 | cystine ABC transporter permease | - |
| EL066_RS14740 | 3069302..3070102 | - | 801 | WP_126483416.1 | cystine ABC transporter substrate-binding protein | - |
| EL066_RS14745 | 3070217..3071209 | - | 993 | WP_126483418.1 | D-cysteine desulfhydrase | - |
| EL066_RS14750 | 3071336..3071845 | - | 510 | WP_126483420.1 | flagella biosynthesis regulatory protein FliZ | - |
| EL066_RS14755 | 3071902..3072624 | - | 723 | WP_126483422.1 | RNA polymerase sigma factor FliA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 7004.29 Da Isoelectric Point: 11.5336
>T286868 WP_006321377.1 NZ_LR134151:3067225-3067407 [Serratia plymuthica]
VKSAELIRLLEREGWVLERIKGSHHQFKHPRSRLVITVPHPRKDLKPGTLRQIMRDAGLC
VKSAELIRLLEREGWVLERIKGSHHQFKHPRSRLVITVPHPRKDLKPGTLRQIMRDAGLC
Download Length: 183 bp
Antitoxin
Download Length: 138 a.a. Molecular weight: 15018.73 Da Isoelectric Point: 4.8469
>AT286868 WP_126483414.1 NZ_LR134151:3067437-3067850 [Serratia plymuthica]
MFYPAYVHSDHDGSASGFFPDVPGCYFAGDTLDIAFEDAKSALDAHFELLSEDNQAIPRPQAVSFHLAQASDTLNGGQWL
LVDINMDKFDGRAERINITLPHRLLNRIDSLVQQHPGYGSRSAFLAAAARNELLKAG
MFYPAYVHSDHDGSASGFFPDVPGCYFAGDTLDIAFEDAKSALDAHFELLSEDNQAIPRPQAVSFHLAQASDTLNGGQWL
LVDINMDKFDGRAERINITLPHRLLNRIDSLVQQHPGYGSRSAFLAAAARNELLKAG
Download Length: 414 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|