Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3666827..3667445 | Replicon | chromosome |
| Accession | NZ_LR134080 | ||
| Organism | Escherichia coli strain NCTC9082 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | EL023_RS18100 | Protein ID | WP_001291435.1 |
| Coordinates | 3667227..3667445 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | EL023_RS18095 | Protein ID | WP_000344800.1 |
| Coordinates | 3666827..3667201 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL023_RS18085 | 3661916..3663109 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| EL023_RS18090 | 3663132..3666281 | + | 3150 | WP_001132469.1 | multidrug efflux RND transporter permease subunit | - |
| EL023_RS18095 | 3666827..3667201 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| EL023_RS18100 | 3667227..3667445 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| EL023_RS18105 | 3667616..3668167 | + | 552 | WP_000102578.1 | maltose O-acetyltransferase | - |
| EL023_RS18110 | 3668283..3668753 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| EL023_RS18115 | 3668917..3670467 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| EL023_RS18120 | 3670509..3670862 | - | 354 | WP_000878141.1 | DUF1428 family protein | - |
| EL023_RS18130 | 3671241..3671552 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| EL023_RS18135 | 3671583..3672155 | - | 573 | WP_000779826.1 | lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T286662 WP_001291435.1 NZ_LR134080:3667227-3667445 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT286662 WP_000344800.1 NZ_LR134080:3666827-3667201 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |