Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 702908..703571 | Replicon | chromosome |
| Accession | NZ_LR133996 | ||
| Organism | Shimwellia blattae strain NCTC10965 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | EL017_RS03365 | Protein ID | WP_002444974.1 |
| Coordinates | 703155..703571 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | I2B5K8 |
| Locus tag | EL017_RS03360 | Protein ID | WP_002444972.1 |
| Coordinates | 702908..703174 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EL017_RS03340 | 698740..699327 | + | 588 | WP_002444964.1 | HD domain-containing protein | - |
| EL017_RS03345 | 699366..700094 | + | 729 | WP_014715822.1 | MurR/RpiR family transcriptional regulator | - |
| EL017_RS03350 | 700230..701663 | + | 1434 | WP_002444968.1 | 6-phospho-beta-glucosidase | - |
| EL017_RS03355 | 701696..702685 | - | 990 | WP_002444970.1 | tRNA-modifying protein YgfZ | - |
| EL017_RS03360 | 702908..703174 | + | 267 | WP_002444972.1 | FAD assembly factor SdhE | Antitoxin |
| EL017_RS03365 | 703155..703571 | + | 417 | WP_002444974.1 | hypothetical protein | Toxin |
| EL017_RS03370 | 703586..704107 | - | 522 | WP_002444975.1 | flavodoxin FldB | - |
| EL017_RS03375 | 704243..705127 | + | 885 | WP_126348978.1 | site-specific tyrosine recombinase XerD | - |
| EL017_RS03380 | 705157..705873 | + | 717 | WP_002444979.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| EL017_RS03385 | 705877..707610 | + | 1734 | WP_002444982.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16236.11 Da Isoelectric Point: 11.2011
>T286547 WP_002444974.1 NZ_LR133996:703155-703571 [Shimwellia blattae]
VVLWQSELRVSWRAQWLSLLLHGIVAAVVLLLPWPLNYLPVWLLLLSLVVLDCVRSQRRINARHGEIKLLDNSQLHWLGR
DWLILGTPWMSRAGMLLRLRDTTTARRHLLWVASDSVDQGEWRDLRRVLAEQKYQPPH
VVLWQSELRVSWRAQWLSLLLHGIVAAVVLLLPWPLNYLPVWLLLLSLVVLDCVRSQRRINARHGEIKLLDNSQLHWLGR
DWLILGTPWMSRAGMLLRLRDTTTARRHLLWVASDSVDQGEWRDLRRVLAEQKYQPPH
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|