Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
| Location | 3338784..3339489 | Replicon | chromosome |
| Accession | NZ_LR130555 | ||
| Organism | Escherichia coli strain MS14385 isolate MS14385 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1F406 |
| Locus tag | EW040_RS16330 | Protein ID | WP_000539521.1 |
| Coordinates | 3338784..3339170 (+) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | EW040_RS16335 | Protein ID | WP_001280945.1 |
| Coordinates | 3339160..3339489 (+) | Length | 110 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW040_RS16310 | 3334788..3335414 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
| EW040_RS16315 | 3335411..3336526 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
| EW040_RS16320 | 3336637..3337020 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
| EW040_RS16325 | 3337233..3338558 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| EW040_RS16330 | 3338784..3339170 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EW040_RS16335 | 3339160..3339489 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
| EW040_RS16340 | 3339559..3340887 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
| EW040_RS16345 | 3340895..3343243 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
| EW040_RS16350 | 3343420..3344331 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T286429 WP_000539521.1 NZ_LR130555:3338784-3339170 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|