Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4416096..4416931 | Replicon | chromosome |
Accession | NZ_LR130545 | ||
Organism | Escherichia coli strain B36 isolate B36 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | EW036_RS22170 | Protein ID | WP_000854759.1 |
Coordinates | 4416096..4416473 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | EW036_RS22175 | Protein ID | WP_001295723.1 |
Coordinates | 4416563..4416931 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EW036_RS22145 | 4412207..4413847 | - | 1641 | WP_001332039.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
EW036_RS22150 | 4414620..4414796 | - | 177 | Protein_4248 | helix-turn-helix domain-containing protein | - |
EW036_RS26755 | 4415160..4415318 | - | 159 | WP_001467148.1 | hypothetical protein | - |
EW036_RS22160 | 4415418..4415594 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
EW036_RS22165 | 4415611..4416099 | - | 489 | WP_000761690.1 | hypothetical protein | - |
EW036_RS22170 | 4416096..4416473 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
EW036_RS22175 | 4416563..4416931 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
EW036_RS22180 | 4417204..4417950 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
EW036_RS22185 | 4417965..4419506 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
EW036_RS22190 | 4419647..4419901 | - | 255 | WP_023281719.1 | DUF987 domain-containing protein | - |
EW036_RS22195 | 4419964..4420440 | - | 477 | WP_001186775.1 | RadC family protein | - |
EW036_RS22200 | 4420456..4420929 | - | 474 | WP_001350782.1 | antirestriction protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T286370 WP_000854759.1 NZ_LR130545:c4416473-4416096 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT286370 WP_001295723.1 NZ_LR130545:c4416931-4416563 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |