Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2982847..2983678 Replicon chromosome
Accession NZ_LR130545
Organism Escherichia coli strain B36 isolate B36

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag EW036_RS15220 Protein ID WP_000854815.1
Coordinates 2983304..2983678 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag EW036_RS15215 Protein ID WP_001280918.1
Coordinates 2982847..2983215 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW036_RS15160 2977936..2978682 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
EW036_RS15170 2978765..2979115 + 351 Protein_2894 hypothetical protein -
EW036_RS15175 2979131..2979541 + 411 WP_000846703.1 hypothetical protein -
EW036_RS15185 2979762..2980580 + 819 WP_001542275.1 DUF945 domain-containing protein -
EW036_RS15190 2980580..2980825 + 246 WP_001164966.1 hypothetical protein -
EW036_RS15195 2980919..2981392 + 474 WP_001542276.1 antirestriction protein -
EW036_RS15200 2981408..2981884 + 477 WP_001186200.1 RadC family protein -
EW036_RS15205 2981947..2982168 + 222 WP_000692345.1 DUF987 domain-containing protein -
EW036_RS15210 2982187..2982831 + 645 WP_000086752.1 hypothetical protein -
EW036_RS15215 2982847..2983215 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EW036_RS15220 2983304..2983678 + 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
EW036_RS15225 2983675..2983869 + 195 WP_000988600.1 hypothetical protein -
EW036_RS15230 2983882..2983995 + 114 WP_001161660.1 DUF957 domain-containing protein -
EW036_RS15235 2984284..2984430 - 147 Protein_2906 transposase domain-containing protein -
EW036_RS15240 2984484..2984666 + 183 WP_001296208.1 hypothetical protein -
EW036_RS15245 2984767..2985096 - 330 WP_000450409.1 DUF496 family protein -
EW036_RS15250 2985268..2986326 - 1059 WP_001200889.1 FUSC family protein -
EW036_RS15255 2986524..2986997 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
EW036_RS15260 2987116..2988282 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T286362 WP_000854815.1 NZ_LR130545:2983304-2983678 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT286362 WP_001280918.1 NZ_LR130545:2982847-2983215 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References