Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2098984..2099205 Replicon chromosome
Accession NZ_LR130545
Organism Escherichia coli strain B36 isolate B36

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag EW036_RS10455 Protein ID WP_001531632.1
Coordinates 2098984..2099091 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2099139..2099205 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EW036_RS10430 2094828..2095910 + 1083 WP_000804726.1 peptide chain release factor 1 -
EW036_RS10435 2095910..2096743 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
EW036_RS10440 2096740..2097132 + 393 WP_000200375.1 invasion regulator SirB2 -
EW036_RS10445 2097136..2097945 + 810 WP_001257044.1 invasion regulator SirB1 -
EW036_RS10450 2097981..2098835 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
EW036_RS10455 2098984..2099091 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2099139..2099205 + 67 NuclAT_10 - Antitoxin
- 2099139..2099205 + 67 NuclAT_10 - Antitoxin
- 2099139..2099205 + 67 NuclAT_10 - Antitoxin
- 2099139..2099205 + 67 NuclAT_10 - Antitoxin
- 2099139..2099205 + 67 NuclAT_5 - Antitoxin
- 2099139..2099205 + 67 NuclAT_5 - Antitoxin
- 2099139..2099205 + 67 NuclAT_5 - Antitoxin
- 2099139..2099205 + 67 NuclAT_5 - Antitoxin
- 2099139..2099205 + 67 NuclAT_6 - Antitoxin
- 2099139..2099205 + 67 NuclAT_6 - Antitoxin
- 2099139..2099205 + 67 NuclAT_6 - Antitoxin
- 2099139..2099205 + 67 NuclAT_6 - Antitoxin
- 2099139..2099205 + 67 NuclAT_7 - Antitoxin
- 2099139..2099205 + 67 NuclAT_7 - Antitoxin
- 2099139..2099205 + 67 NuclAT_7 - Antitoxin
- 2099139..2099205 + 67 NuclAT_7 - Antitoxin
- 2099139..2099205 + 67 NuclAT_8 - Antitoxin
- 2099139..2099205 + 67 NuclAT_8 - Antitoxin
- 2099139..2099205 + 67 NuclAT_8 - Antitoxin
- 2099139..2099205 + 67 NuclAT_8 - Antitoxin
- 2099139..2099205 + 67 NuclAT_9 - Antitoxin
- 2099139..2099205 + 67 NuclAT_9 - Antitoxin
- 2099139..2099205 + 67 NuclAT_9 - Antitoxin
- 2099139..2099205 + 67 NuclAT_9 - Antitoxin
- 2099141..2099204 + 64 NuclAT_12 - -
- 2099141..2099204 + 64 NuclAT_12 - -
- 2099141..2099204 + 64 NuclAT_12 - -
- 2099141..2099204 + 64 NuclAT_12 - -
- 2099141..2099204 + 64 NuclAT_13 - -
- 2099141..2099204 + 64 NuclAT_13 - -
- 2099141..2099204 + 64 NuclAT_13 - -
- 2099141..2099204 + 64 NuclAT_13 - -
- 2099141..2099204 + 64 NuclAT_14 - -
- 2099141..2099204 + 64 NuclAT_14 - -
- 2099141..2099204 + 64 NuclAT_14 - -
- 2099141..2099204 + 64 NuclAT_14 - -
- 2099141..2099204 + 64 NuclAT_15 - -
- 2099141..2099204 + 64 NuclAT_15 - -
- 2099141..2099204 + 64 NuclAT_15 - -
- 2099141..2099204 + 64 NuclAT_15 - -
- 2099141..2099204 + 64 NuclAT_16 - -
- 2099141..2099204 + 64 NuclAT_16 - -
- 2099141..2099204 + 64 NuclAT_16 - -
- 2099141..2099204 + 64 NuclAT_16 - -
- 2099141..2099204 + 64 NuclAT_17 - -
- 2099141..2099204 + 64 NuclAT_17 - -
- 2099141..2099204 + 64 NuclAT_17 - -
- 2099141..2099204 + 64 NuclAT_17 - -
- 2099141..2099206 + 66 NuclAT_18 - -
- 2099141..2099206 + 66 NuclAT_18 - -
- 2099141..2099206 + 66 NuclAT_18 - -
- 2099141..2099206 + 66 NuclAT_18 - -
- 2099141..2099206 + 66 NuclAT_19 - -
- 2099141..2099206 + 66 NuclAT_19 - -
- 2099141..2099206 + 66 NuclAT_19 - -
- 2099141..2099206 + 66 NuclAT_19 - -
- 2099141..2099206 + 66 NuclAT_20 - -
- 2099141..2099206 + 66 NuclAT_20 - -
- 2099141..2099206 + 66 NuclAT_20 - -
- 2099141..2099206 + 66 NuclAT_20 - -
- 2099141..2099206 + 66 NuclAT_21 - -
- 2099141..2099206 + 66 NuclAT_21 - -
- 2099141..2099206 + 66 NuclAT_21 - -
- 2099141..2099206 + 66 NuclAT_21 - -
- 2099141..2099206 + 66 NuclAT_22 - -
- 2099141..2099206 + 66 NuclAT_22 - -
- 2099141..2099206 + 66 NuclAT_22 - -
- 2099141..2099206 + 66 NuclAT_22 - -
- 2099141..2099206 + 66 NuclAT_23 - -
- 2099141..2099206 + 66 NuclAT_23 - -
- 2099141..2099206 + 66 NuclAT_23 - -
- 2099141..2099206 + 66 NuclAT_23 - -
EW036_RS10460 2099496..2100596 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
EW036_RS10465 2100866..2101105 + 240 WP_000120702.1 putative cation transport regulator ChaB -
EW036_RS10470 2101254..2101949 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
EW036_RS10475 2101993..2102346 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
EW036_RS10480 2102531..2103925 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T286353 WP_001531632.1 NZ_LR130545:c2099091-2098984 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp


Antitoxin


Download         Length: 67 bp

>AT286353 NZ_LR130545:2099139-2099205 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9


Antitoxin

Download structure file

References