Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4864086..4864602 | Replicon | chromosome |
| Accession | NZ_LR130544 | ||
| Organism | Klebsiella variicola strain 03-311-0071 isolate 03-311-0071 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | J2XDK6 |
| Locus tag | EW041_RS23710 | Protein ID | WP_002886902.1 |
| Coordinates | 4864086..4864370 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | EW041_RS23715 | Protein ID | WP_047667304.1 |
| Coordinates | 4864360..4864602 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW041_RS23695 | 4859189..4860844 | + | 1656 | WP_129766172.1 | alpha,alpha-phosphotrehalase | - |
| EW041_RS23700 | 4861230..4863368 | + | 2139 | WP_044614392.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| EW041_RS23705 | 4863618..4864082 | + | 465 | WP_012969085.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| EW041_RS23710 | 4864086..4864370 | - | 285 | WP_002886902.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| EW041_RS23715 | 4864360..4864602 | - | 243 | WP_047667304.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| EW041_RS23720 | 4864680..4866590 | - | 1911 | WP_129766173.1 | BglG family transcription antiterminator | - |
| EW041_RS23725 | 4866613..4867767 | - | 1155 | WP_012543086.1 | lactonase family protein | - |
| EW041_RS23730 | 4867893..4868633 | - | 741 | WP_008807137.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.3787
>T286345 WP_002886902.1 NZ_LR130544:c4864370-4864086 [Klebsiella variicola]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNPRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|