Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4756824..4757515 | Replicon | chromosome |
| Accession | NZ_LR130541 | ||
| Organism | Klebsiella pneumoniae strain AJ218 isolate AJ218 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | A0A483YFJ1 |
| Locus tag | EW045_RS23595 | Protein ID | WP_025987721.1 |
| Coordinates | 4756824..4757165 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A2A5MHA6 |
| Locus tag | EW045_RS23600 | Protein ID | WP_019725272.1 |
| Coordinates | 4757189..4757515 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EW045_RS23585 | 4753525..4755249 | - | 1725 | WP_048269794.1 | retron Ec67 family RNA-directed DNA polymerase/endonuclease | - |
| EW045_RS23590 | 4755876..4756709 | - | 834 | WP_048269810.1 | DUF4942 domain-containing protein | - |
| EW045_RS23595 | 4756824..4757165 | - | 342 | WP_025987721.1 | TA system toxin CbtA family protein | Toxin |
| EW045_RS23600 | 4757189..4757515 | - | 327 | WP_019725272.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EW045_RS23605 | 4757529..4758005 | - | 477 | WP_048269792.1 | DNA repair protein RadC | - |
| EW045_RS23610 | 4758016..4758462 | - | 447 | WP_048269791.1 | antirestriction protein | - |
| EW045_RS23615 | 4758686..4759375 | - | 690 | WP_048269790.1 | hypothetical protein | - |
| EW045_RS23620 | 4759695..4760048 | + | 354 | WP_048269789.1 | hypothetical protein | - |
| EW045_RS23625 | 4760085..4760975 | - | 891 | WP_048269788.1 | 50S ribosome-binding GTPase | - |
| EW045_RS23630 | 4761058..4762146 | - | 1089 | WP_048269787.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4739779..4775715 | 35936 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12867.90 Da Isoelectric Point: 8.5195
>T286313 WP_025987721.1 NZ_LR130541:c4757165-4756824 [Klebsiella pneumoniae]
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTLNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A483YFJ1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2A5MHA6 |