Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) TscAT/-
Location 938723..939228 Replicon chromosome
Accession NZ_LR027873
Organism Staphylococcus aureus strain BPH2070 isolate BPH2070

Toxin (Protein)


Gene name TscT Uniprot ID A0A0C6E6D5
Locus tag E0E08_RS04820 Protein ID WP_001103946.1
Coordinates 938935..939228 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name TscA Uniprot ID X5IA75
Locus tag E0E08_RS04815 Protein ID WP_001058492.1
Coordinates 938723..938932 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E0E08_RS04780 934240..935460 - 1221 WP_000264182.1 site-specific integrase -
E0E08_RS04785 935548..936276 - 729 WP_000733773.1 staphylococcal enterotoxin type K -
E0E08_RS04790 936300..937028 - 729 WP_001033317.1 staphylococcal enterotoxin type Q -
E0E08_RS04795 937203..937937 - 735 WP_000142630.1 helix-turn-helix domain-containing protein -
E0E08_RS04800 938087..938299 + 213 WP_001063624.1 helix-turn-helix transcriptional regulator -
E0E08_RS04805 938300..938572 + 273 WP_001138298.1 helix-turn-helix domain-containing protein -
E0E08_RS04810 938584..938730 + 147 WP_000784885.1 hypothetical protein -
E0E08_RS04815 938723..938932 + 210 WP_001058492.1 hypothetical protein Antitoxin
E0E08_RS04820 938935..939228 + 294 WP_001103946.1 DUF1474 family protein Toxin
E0E08_RS04825 939316..940185 + 870 WP_001002692.1 primase alpha helix C-terminal domain-containing protein -
E0E08_RS04830 940202..941659 + 1458 WP_000432707.1 virulence-associated E family protein -
E0E08_RS04835 941961..942323 + 363 WP_001039172.1 hypothetical protein -
E0E08_RS04840 942325..942609 + 285 WP_000998180.1 hypothetical protein -
E0E08_RS04845 942606..943247 + 642 WP_001019783.1 hypothetical protein -
E0E08_RS04850 943696..944037 + 342 WP_001190616.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage ant(9)-Ia / erm(A) selk / selq 909603..946351 36748


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Protein of unknown function DUF1474

(1-97)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11590.08 Da        Isoelectric Point: 4.9594

>T286024 WP_001103946.1 NZ_LR027873:938935-939228 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLQVYLKEFGELIQKF
HEIEKASLQADQSESNA

Download         Length: 294 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 8238.28 Da        Isoelectric Point: 4.3718

>AT286024 WP_001058492.1 NZ_LR027873:938723-938932 [Staphylococcus aureus]
MNNEQKEVIEHVVYQLELSVMNNLESYEHTEYVNGIEVVSEISREKHLELIMKWCAQELKNNFQLEKGE

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0C6E6D5

Antitoxin

Source ID Structure
AlphaFold DB X5IA75

References