Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3059984..3060815 Replicon chromosome
Accession NZ_LR025101
Organism Escherichia coli isolate EC-1639

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag EC1639_RS14900 Protein ID WP_000854814.1
Coordinates 3060441..3060815 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B3Y195
Locus tag EC1639_RS14895 Protein ID WP_001285585.1
Coordinates 3059984..3060352 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC1639_RS14855 3055970..3056812 + 843 Protein_2823 hypothetical protein -
EC1639_RS14860 3056888..3057343 + 456 WP_000581504.1 hypothetical protein -
EC1639_RS14865 3057422..3057655 + 234 WP_001119729.1 DUF905 family protein -
EC1639_RS14875 3057755..3058573 + 819 WP_021538423.1 DUF945 domain-containing protein -
EC1639_RS14880 3058655..3059134 + 480 WP_000860087.1 antirestriction protein -
EC1639_RS14885 3059150..3059626 + 477 WP_001186726.1 RadC family protein -
EC1639_RS14890 3059689..3059910 + 222 WP_000692323.1 DUF987 domain-containing protein -
EC1639_RS14895 3059984..3060352 + 369 WP_001285585.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
EC1639_RS14900 3060441..3060815 + 375 WP_000854814.1 type IV toxin-antitoxin system toxin CbtA Toxin
EC1639_RS14905 3060812..3061006 + 195 WP_000988600.1 hypothetical protein -
EC1639_RS14910 3061019..3061132 + 114 WP_001161660.1 DUF957 domain-containing protein -
EC1639_RS14915 3061421..3061549 - 129 Protein_2834 transposase domain-containing protein -
EC1639_RS14920 3061621..3061803 + 183 WP_032140263.1 ethanolamine utilization protein -
EC1639_RS14925 3061904..3062233 - 330 WP_000450409.1 DUF496 family protein -
EC1639_RS14930 3062405..3063463 - 1059 WP_001200891.1 FUSC family protein -
EC1639_RS14935 3063661..3064134 - 474 WP_001105389.1 DNA gyrase inhibitor SbmC -
EC1639_RS14940 3064253..3065419 - 1167 WP_000830150.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T285908 WP_000854814.1 NZ_LR025101:3060441-3060815 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13593.48 Da        Isoelectric Point: 6.3139

>AT285908 WP_001285585.1 NZ_LR025101:3059984-3060352 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LW60

References