Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 90535..91082 Replicon plasmid 2
Accession NZ_LR025097
Organism Escherichia coli isolate EC-7215

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag EC7215_RS24055 Protein ID WP_042047819.1
Coordinates 90801..91082 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A075M9N8
Locus tag EC7215_RS24050 Protein ID WP_032072813.1
Coordinates 90535..90804 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC7215_RS24005 85873..87624 + 1752 Protein_104 Tn3-like element TnAs1 family transposase -
EC7215_RS24010 87657..87971 + 315 Protein_105 DUF2726 domain-containing protein -
EC7215_RS24015 88210..88470 + 261 WP_000083818.1 replication regulatory protein RepA -
EC7215_RS24025 88696..88770 + 75 WP_001365705.1 RepA leader peptide Tap -
EC7215_RS24030 88763..89620 + 858 WP_000130940.1 incFII family plasmid replication initiator RepA -
EC7215_RS24050 90535..90804 + 270 WP_032072813.1 prevent host death protein Phd antitoxin Antitoxin
EC7215_RS24055 90801..91082 + 282 WP_042047819.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
EC7215_RS24060 91128..91976 + 849 WP_054444119.1 3'-5' exonuclease -
EC7215_RS24065 92093..92574 + 482 Protein_112 hypothetical protein -
EC7215_RS24075 92876..93223 + 348 WP_000142437.1 hypothetical protein -
EC7215_RS24080 93767..94464 + 698 Protein_114 IS1 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid dfrA14 / mph(A) / blaTEM-1B / aadA2 / sul3 / ant(3'')-Ia / aph(3')-Ia / aph(3'')-Ib / aph(6)-Id / floR / tet(A) / sitABCD iroN / iroE / iroD / iroC / iroB 1..142200 142200
- flank IS/Tn - - 93961..94464 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10948.65 Da        Isoelectric Point: 8.4615

>T285870 WP_042047819.1 NZ_LR025097:90801-91082 [Escherichia coli]
MMEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASNLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKV
YILRVLHTVQKWP

Download         Length: 282 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10277.64 Da        Isoelectric Point: 10.2879

>AT285870 WP_032072813.1 NZ_LR025097:90535-90804 [Escherichia coli]
MAQVNMNLRINAEIKNAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A075M9N8

References