Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) pemIK/PRK09812-MazE
Location 812021..812610 Replicon chromosome
Accession NZ_LN879429
Organism Bartonella henselae strain MVT02

Toxin (Protein)


Gene name pemK Uniprot ID X5M710
Locus tag BM1374164_RS03415 Protein ID WP_011180620.1
Coordinates 812278..812610 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID X5LZ85
Locus tag BM1374164_RS03410 Protein ID WP_034459411.1
Coordinates 812021..812278 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
BM1374164_RS03370 807396..807875 + 480 WP_011180611.1 hypothetical protein -
BM1374164_RS03375 807865..809115 + 1251 WP_034448599.1 DUF1376 domain-containing protein -
BM1374164_RS08360 809099..809485 + 387 WP_082246570.1 hypothetical protein -
BM1374164_RS03385 809667..809987 + 321 Protein_658 hypothetical protein -
BM1374164_RS03390 810175..810447 - 273 WP_011180615.1 type II toxin-antitoxin system mRNA interferase toxin, RelE/StbE family -
BM1374164_RS03395 810444..810734 - 291 WP_011180616.1 hypothetical protein -
BM1374164_RS03400 810946..811392 + 447 WP_011180617.1 single-stranded DNA-binding protein -
BM1374164_RS03405 811446..811940 + 495 WP_034448601.1 hypothetical protein -
BM1374164_RS03410 812021..812278 + 258 WP_034459411.1 antitoxin Antitoxin
BM1374164_RS03415 812278..812610 + 333 WP_011180620.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
BM1374164_RS03420 812718..812945 + 228 WP_007346764.1 ribbon-helix-helix protein, CopG family -
BM1374164_RS03425 812929..813198 + 270 WP_011180622.1 type II toxin-antitoxin system RelE/ParE family toxin -
BM1374164_RS03430 813716..814174 - 459 WP_011180624.1 hypothetical protein -
BM1374164_RS03435 814473..814799 + 327 WP_051523598.1 hypothetical protein -
BM1374164_RS03440 814780..815919 + 1140 WP_051523599.1 phage terminase large subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 788581..815919 27338


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11865.88 Da        Isoelectric Point: 10.5590

>T285746 WP_011180620.1 NZ_LN879429:812278-812610 [Bartonella henselae]
MKRGEIWLVSLDPTSGYEQKGTRPVLIVSPEAFNRVTKTPIVLPITSGGNFSRTAGFAVSLVGTGLHTTGVIRCDQPRAL
DIAARQGKKMETVPPIIMNEVLAKLSTFLT

Download         Length: 333 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9436.79 Da        Isoelectric Point: 4.3536

>AT285746 WP_034459411.1 NZ_LN879429:812021-812278 [Bartonella henselae]
MHTTKLRKVGGSVMLSIPPALLDVLHLTENTQVGLAVDNGQLVVKPQTFPSYTLDELLAQCHLSDDFSDEDMEWFDAKPV
GRELL

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A067W4K9

Antitoxin

Source ID Structure
AlphaFold DB A0A067W7K8

References