Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 148167..148672 | Replicon | chromosome |
| Accession | NZ_LN870292 | ||
| Organism | Pseudomonas aeruginosa DK1 substr. NH57388A | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PADK1_RS00665 | Protein ID | WP_003083773.1 |
| Coordinates | 148167..148448 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PADK1_RS00670 | Protein ID | WP_003083775.1 |
| Coordinates | 148445..148672 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PADK1_RS00640 | 143418..144767 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| PADK1_RS00645 | 144816..145502 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
| PADK1_RS00650 | 145603..146337 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
| PADK1_RS00655 | 146541..146927 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
| PADK1_RS00660 | 146959..147867 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PADK1_RS00665 | 148167..148448 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PADK1_RS00670 | 148445..148672 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PADK1_RS00675 | 148848..149468 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PADK1_RS00680 | 149569..150069 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PADK1_RS00685 | 150142..150483 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
| PADK1_RS00690 | 150565..151992 | - | 1428 | WP_003117210.1 | GABA permease | - |
| PADK1_RS00695 | 152161..153654 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T285730 WP_003083773.1 NZ_LN870292:c148448-148167 [Pseudomonas aeruginosa DK1]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|