Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YafN(antitoxin) |
| Location | 1754749..1755314 | Replicon | chromosome |
| Accession | NZ_HG992749 | ||
| Organism | Vibrio sp. B1FLJ16 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A7X8U0A9 |
| Locus tag | KHN79_RS07970 | Protein ID | WP_029865673.1 |
| Coordinates | 1754749..1755036 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | KHN79_RS07975 | Protein ID | WP_017420803.1 |
| Coordinates | 1755033..1755314 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KHN79_RS07950 (ACOMICROBIO_LOCUS1172) | 1751121..1751813 | + | 693 | WP_182011762.1 | NAD(P)H-binding protein | - |
| KHN79_RS07955 (ACOMICROBIO_LOCUS1173) | 1752003..1753382 | + | 1380 | WP_182011761.1 | L-cystine transporter | - |
| KHN79_RS07960 (ACOMICROBIO_FLGHMIGD_01612) | 1753742..1754095 | - | 354 | WP_182011760.1 | DUF1428 domain-containing protein | - |
| KHN79_RS07965 | 1754219..1754350 | + | 132 | Protein_1537 | IS110 family transposase | - |
| KHN79_RS07970 (ACOMICROBIO_FLGHMIGD_01613) | 1754749..1755036 | - | 288 | WP_029865673.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KHN79_RS07975 (ACOMICROBIO_LOCUS1174) | 1755033..1755314 | - | 282 | WP_017420803.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| KHN79_RS21600 | 1755405..1755515 | - | 111 | WP_244812636.1 | DUF3265 domain-containing protein | - |
| KHN79_RS07980 (ACOMICROBIO_FLGHMIGD_01615) | 1755512..1756213 | - | 702 | WP_182011759.1 | hypothetical protein | - |
| KHN79_RS07990 (ACOMICROBIO_FLGHMIGD_01616) | 1756375..1757034 | - | 660 | WP_182011767.1 | hypothetical protein | - |
| KHN79_RS07995 (ACOMICROBIO_LOCUS1175) | 1757297..1757836 | - | 540 | WP_244812548.1 | class I SAM-dependent methyltransferase | - |
| KHN79_RS08000 (ACOMICROBIO_LOCUS1176) | 1757967..1758938 | - | 972 | WP_182011757.1 | HNH endonuclease | - |
| KHN79_RS08005 (ACOMICROBIO_LOCUS1177) | 1759085..1759465 | - | 381 | WP_182011766.1 | VOC family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10993.65 Da Isoelectric Point: 5.1098
>T285276 WP_029865673.1 NZ_HG992749:c1755036-1754749 [Vibrio sp. B1FLJ16]
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV
MKVVWSPLALQKLGDAAEFISLDNPSAAEKWVNEVFDKTELLGSMPEMGRFVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQILSEDDV
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|