Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5204308..5204897 | Replicon | chromosome |
| Accession | NZ_HG992338 | ||
| Organism | Xanthomonas arboricola pv. corylina strain 301 isolate 301 | ||
Toxin (Protein)
| Gene name | graT | Uniprot ID | A0A2N7V9W3 |
| Locus tag | P3C56_RS22325 | Protein ID | WP_016902142.1 |
| Coordinates | 5204616..5204897 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | graA | Uniprot ID | - |
| Locus tag | P3C56_RS22320 | Protein ID | WP_026064232.1 |
| Coordinates | 5204308..5204598 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3C56_RS22290 | 5200433..5201014 | + | 582 | WP_275544325.1 | ParA family protein | - |
| P3C56_RS22295 (XAC301_44390) | 5201028..5201990 | - | 963 | WP_070689987.1 | IS1595 family transposase | - |
| P3C56_RS22300 | 5202101..5202613 | + | 513 | WP_275544326.1 | hypothetical protein | - |
| P3C56_RS22305 (XAC301_44400) | 5202628..5203275 | + | 648 | WP_104536557.1 | RelA/SpoT domain-containing protein | - |
| P3C56_RS22310 (XAC301_44410) | 5203433..5203765 | + | 333 | WP_026064233.1 | hypothetical protein | - |
| P3C56_RS22315 | 5203915..5204117 | + | 203 | Protein_4363 | hypothetical protein | - |
| P3C56_RS22320 (XAC301_44430) | 5204308..5204598 | - | 291 | WP_026064232.1 | HigA family addiction module antitoxin | Antitoxin |
| P3C56_RS22325 (XAC301_44440) | 5204616..5204897 | - | 282 | WP_016902142.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3C56_RS22330 (XAC301_44450) | 5205037..5207163 | - | 2127 | WP_275548228.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11064.75 Da Isoelectric Point: 9.7972
>T285262 WP_016902142.1 NZ_HG992338:c5204897-5204616 [Xanthomonas arboricola pv. corylina]
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
MIRSFVDKEAEKIWMGERSRRLPADIQSVARRKLRMLNAAAHLDDLRIPPANRLEALKGERRGQYSIRINDQWRICFRWM
EGDVAEVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|