Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 128884..129527 Replicon plasmid pEC958
Accession NZ_HG941719
Organism Escherichia coli O25b:H4-ST131 strain EC958

Toxin (Protein)


Gene name vagD Uniprot ID C7S9Y5
Locus tag EC958_RS26325 Protein ID WP_001034046.1
Coordinates 128884..129300 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID V0SR71
Locus tag EC958_RS26330 Protein ID WP_001261278.1
Coordinates 129297..129527 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC958_RS26310 124021..124437 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
EC958_RS26315 124434..124664 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
EC958_RS26320 125045..128839 + 3795 WP_001144732.1 hypothetical protein -
EC958_RS26325 128884..129300 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin Toxin
EC958_RS26330 129297..129527 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
EC958_RS26335 129792..130292 + 501 WP_000528932.1 hypothetical protein -
EC958_RS26340 130305..131078 + 774 WP_000905949.1 hypothetical protein -
EC958_RS26345 131289..132902 - 1614 WP_000080195.1 IS66-like element ISEc23 family transposase -
EC958_RS26350 132933..133283 - 351 WP_000624722.1 IS66 family insertion sequence element accessory protein TnpB -
EC958_RS26355 133280..133705 - 426 WP_000422741.1 IS66 family insertion sequence hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) - 1..135602 135602


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-53)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14978.31 Da        Isoelectric Point: 6.7113

>T285219 WP_001034046.1 NZ_HG941719:c129300-128884 [Escherichia coli O25b:H4-ST131]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8853.07 Da        Isoelectric Point: 4.6437

>AT285219 WP_001261278.1 NZ_HG941719:c129527-129297 [Escherichia coli O25b:H4-ST131]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDRIILRPLRPSWSSFLELEKADPGFMTEREDVVCDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9NXF9

Antitoxin

Source ID Structure
AlphaFold DB V0SR71

References