Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 128884..129527 | Replicon | plasmid pEC958 |
| Accession | NZ_HG941719 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain EC958 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | EC958_RS26325 | Protein ID | WP_001034046.1 |
| Coordinates | 128884..129300 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | EC958_RS26330 | Protein ID | WP_001261278.1 |
| Coordinates | 129297..129527 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC958_RS26310 | 124021..124437 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| EC958_RS26315 | 124434..124664 | - | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| EC958_RS26320 | 125045..128839 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| EC958_RS26325 | 128884..129300 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| EC958_RS26330 | 129297..129527 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| EC958_RS26335 | 129792..130292 | + | 501 | WP_000528932.1 | hypothetical protein | - |
| EC958_RS26340 | 130305..131078 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| EC958_RS26345 | 131289..132902 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| EC958_RS26350 | 132933..133283 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| EC958_RS26355 | 133280..133705 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) | - | 1..135602 | 135602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T285219 WP_001034046.1 NZ_HG941719:c129300-128884 [Escherichia coli O25b:H4-ST131]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |