Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 22847..23116 | Replicon | plasmid pEC958 |
| Accession | NZ_HG941719 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain EC958 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | EC958_RS25735 | Protein ID | WP_001312861.1 |
| Coordinates | 22958..23116 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 22847..22912 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC958_RS25705 | 18682..19167 | + | 486 | WP_042029316.1 | single-stranded DNA-binding protein | - |
| EC958_RS25710 | 19223..19456 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
| EC958_RS25715 | 19515..21473 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
| EC958_RS25720 | 21528..21962 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
| EC958_RS25725 | 21959..22678 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
| EC958_RS29470 | 22690..22878 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - | 22690..22914 | + | 225 | NuclAT_0 | - | - |
| - | 22690..22914 | + | 225 | NuclAT_0 | - | - |
| - | 22690..22914 | + | 225 | NuclAT_0 | - | - |
| - | 22690..22914 | + | 225 | NuclAT_0 | - | - |
| - | 22847..22912 | - | 66 | - | - | Antitoxin |
| EC958_RS25735 | 22958..23116 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| EC958_RS25745 | 24035..24322 | + | 288 | WP_000107537.1 | hypothetical protein | - |
| EC958_RS25750 | 24443..25264 | + | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
| EC958_RS25755 | 25563..26210 | - | 648 | WP_000614282.1 | transglycosylase SLT domain-containing protein | - |
| EC958_RS25760 | 26496..26879 | + | 384 | WP_001151564.1 | relaxosome protein TraM | - |
| EC958_RS25765 | 27073..27759 | + | 687 | WP_000332487.1 | PAS domain-containing protein | - |
| EC958_RS25770 | 27853..28080 | + | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / aadA5 / qacE / sul1 / mph(A) / blaCTX-M-15 / blaOXA-1 / aac(6')-Ib-cr / tet(A) | - | 1..135602 | 135602 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T285216 WP_001312861.1 NZ_HG941719:22958-23116 [Escherichia coli O25b:H4-ST131]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
Antitoxin
Download Length: 66 bp
>AT285216 NZ_HG941719:c22912-22847 [Escherichia coli O25b:H4-ST131]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|