Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4974597..4975432 | Replicon | chromosome |
| Accession | NZ_HG941718 | ||
| Organism | Escherichia coli O25b:H4-ST131 strain EC958 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | EC958_RS24870 | Protein ID | WP_000854759.1 |
| Coordinates | 4975055..4975432 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | EC958_RS24865 | Protein ID | WP_001295723.1 |
| Coordinates | 4974597..4974965 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EC958_RS24835 | 4970599..4971072 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| EC958_RS24840 | 4971088..4971564 | + | 477 | WP_001186775.1 | RadC family protein | - |
| EC958_RS24845 | 4971627..4971881 | + | 255 | WP_023281719.1 | DUF987 domain-containing protein | - |
| EC958_RS24850 | 4972022..4973563 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| EC958_RS24855 | 4973578..4974324 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| EC958_RS24865 | 4974597..4974965 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| EC958_RS24870 | 4975055..4975432 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| EC958_RS24875 | 4975429..4975917 | + | 489 | WP_000761690.1 | hypothetical protein | - |
| EC958_RS24880 | 4975934..4976110 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| EC958_RS29720 | 4976210..4976368 | + | 159 | WP_001467148.1 | hypothetical protein | - |
| EC958_RS29445 | 4976732..4976908 | + | 177 | Protein_4704 | helix-turn-helix domain-containing protein | - |
| EC958_RS24890 | 4977681..4979321 | + | 1641 | WP_001332039.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T285210 WP_000854759.1 NZ_HG941718:4975055-4975432 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT285210 WP_001295723.1 NZ_HG941718:4974597-4974965 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |