Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2277770..2278601 Replicon chromosome
Accession NZ_HG941718
Organism Escherichia coli O25b:H4-ST131 strain EC958

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag EC958_RS11825 Protein ID WP_000854815.1
Coordinates 2278227..2278601 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag EC958_RS11820 Protein ID WP_001280918.1
Coordinates 2277770..2278138 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EC958_RS11775 2272859..2273605 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
EC958_RS11780 2273688..2274038 + 351 Protein_2246 hypothetical protein -
EC958_RS11785 2274054..2274464 + 411 WP_000846703.1 hypothetical protein -
EC958_RS11790 2274685..2275503 + 819 WP_001542275.1 DUF945 domain-containing protein -
EC958_RS11795 2275503..2275748 + 246 WP_001164966.1 hypothetical protein -
EC958_RS11800 2275842..2276315 + 474 WP_001542276.1 antirestriction protein -
EC958_RS11805 2276331..2276807 + 477 WP_001186200.1 RadC family protein -
EC958_RS11810 2276870..2277091 + 222 WP_000692345.1 DUF987 domain-containing protein -
EC958_RS11815 2277110..2277754 + 645 WP_000086752.1 hypothetical protein -
EC958_RS11820 2277770..2278138 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
EC958_RS11825 2278227..2278601 + 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
EC958_RS11830 2278598..2278792 + 195 WP_000988600.1 hypothetical protein -
EC958_RS29535 2278805..2278918 + 114 WP_001161660.1 DUF957 domain-containing protein -
EC958_RS29270 2279207..2279353 - 147 Protein_2258 transposase domain-containing protein -
EC958_RS29275 2279407..2279589 + 183 WP_001296208.1 hypothetical protein -
EC958_RS11845 2279690..2280019 - 330 WP_000450409.1 DUF496 family protein -
EC958_RS11850 2280191..2281249 - 1059 WP_001200889.1 FUSC family protein -
EC958_RS11855 2281447..2281920 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
EC958_RS11860 2282039..2283205 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T285198 WP_000854815.1 NZ_HG941718:2278227-2278601 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT285198 WP_001280918.1 NZ_HG941718:2277770-2278138 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References