Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09812-PrlF
Location 1248848..1249403 Replicon chromosome
Accession NZ_HG938355
Organism Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI 1141

Toxin (Protein)


Gene name mazF Uniprot ID A0A068T593
Locus tag RG1141_RS06475 Protein ID WP_038542202.1
Coordinates 1249050..1249403 (+) Length 118 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A068T560
Locus tag RG1141_RS06470 Protein ID WP_038542199.1
Coordinates 1248848..1249063 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
RG1141_RS06445 1244294..1244959 - 666 WP_038542187.1 protein-methionine-sulfoxide reductase heme-binding subunit MsrQ -
RG1141_RS06450 1244962..1245906 - 945 WP_038549051.1 protein-methionine-sulfoxide reductase catalytic subunit MsrP -
RG1141_RS06455 1246116..1246526 + 411 WP_038542190.1 DUF4112 domain-containing protein -
RG1141_RS06460 1246528..1246716 - 189 WP_038542193.1 DUF1902 domain-containing protein -
RG1141_RS06465 1246935..1248770 + 1836 WP_038542196.1 dihydroxy-acid dehydratase -
RG1141_RS06470 1248848..1249063 + 216 WP_038542199.1 type II toxin-antitoxin system PrlF family antitoxin Antitoxin
RG1141_RS06475 1249050..1249403 + 354 WP_038542202.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
RG1141_RS06480 1249411..1249773 - 363 WP_038542205.1 periplasmic protein -
RG1141_RS06485 1249811..1250191 - 381 WP_038542208.1 DUF1232 domain-containing protein -
RG1141_RS06490 1250327..1251727 + 1401 WP_038542211.1 DegQ family serine endoprotease -
RG1141_RS06495 1251724..1253040 + 1317 WP_038542214.1 replication-associated recombination protein A -
RG1141_RS06500 1253059..1253373 - 315 WP_038549053.1 DUF1883 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(5-106)

Antitoxin

PrlF antitoxin

(4-53)


Sequences

Toxin        


Download         Length: 118 a.a.        Molecular weight: 12805.86 Da        Isoelectric Point: 8.7568

>T285161 WP_038542202.1 NZ_HG938355:1249050-1249403 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MPIFERGDIVRVPFPYTDRDTRQRRPALVVSSAIGEGAALLWVVMITSAENRRWADDIPILDHASAGLPAPSVVRPVKIA
TVEARHVEAIGKLPDEISRSVIRRIAGILSTALNAEM

Download         Length: 354 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8030.96 Da        Isoelectric Point: 4.3569

>AT285161 WP_038542199.1 NZ_HG938355:1248848-1249063 [Neorhizobium galegae bv. officinalis bv. officinalis str. HAMBI]
MITSRLTSKSQTTIPQPVRTALKLREGDELVYTFEPDGRVLIARASQPVDDPFATFDEWDSEADRKAYADL

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A068T593

Antitoxin

Source ID Structure
AlphaFold DB A0A068T560

References